GenomeNet

>ray:107498677 K10801 methyl-CpG-binding domain protein 4 [EC:3.2.2.-] | (RefSeq) MBD4; methyl-CpG-binding domain protein 4 isoform X1 (A)
MESPSLGNCEAAHLVASSERLVPERPCDLRKEDVAVGSESIEDEKQMVIKSSSECNTLLQ
EPIAASQFGGTEITECHKSVPCGWERVVKQRVSGKTAGRYDVYFISPQGLKFRSKSSLAN
YLHKNEETSLKPEDFDFTVLSKRGIKSKYKDCSMVAQTSQLQNESSISNRNLRTRSRWKK
DVFPLPSGSLELQESRKLANVNSIDLLLKENESVNDVDSKKVRKSKGKMTILKGIQIKKT
KTGSRESLLDSVQSNIKRESVYNKAEAESESVVQENQLNRTFCISDTKKSDKTFNVTSEE
KRLMKEKSLSSRSNFSFEQITSGIINKLCSTKEAEHMEKCKDTISESEEIRTKVEAGERK
EHLHIDNLKYGSEMDNNCLQTEKESTVKICQEDTIPRTQTEKRKTSLYFSSKYNKEALSP
PRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPSAE
VARTADWRDVSELLKPLGLYELRAKNIIKFSDEYLTKQWRYPIELHGIGKYGNDSYRIFC
INEWKQVHPEDHKLNKYHDWLWENHEKLSLS

BLAST