GenomeNet

>rby:CEJ39_07215 K07058 membrane protein | (GenBank) YihY/virulence factor BrkB family protein (A)
MDAEHRGDGSSGATLAPDDPRKPDSPTDLSTPSWKYVLRRTIREFSRDQCTDLAAALTYY
AVLSLFPALLVVVSLLGVFGQGQTTVDTVLGMVEDLGPSSAVDTLRGPIEQLVSAPTAGF
ALIVGILGALWSASGYVGAFGRAMNRIYEIEEGRPVWKLRPLMLLITAVALVAAGTTALM
LVISGPVARTIGDVIGLGDTAVTVWNIVKWPVMLALVVMIVAVLYYATPNVSQPKFRWVS
LGSLIAIVVWIVASVAFAFYVSNFGSYNKTYGSLAGAVIFLLWLWITNLALLFGAEFDAE
MERGRQLQAGMPAEKTLQLPERDSRASEKNAAKLEELVEHGRKLREAHNADGSSGEAADP
VGPTGPTTERNPR

BLAST