GenomeNet

>rli:RLO149_c000090 K21929 uracil-DNA glycosylase [EC:3.2.2.27] | (GenBank) uracil DNA glycosylase-like protein (A)
MPHVTLPRIGTAQAWRDAARGFLNAHIPPEQITWGDSTTEPGLFETLVPTFVPGTATVPR
SFVSMANTIVWHSDPSRFARLYAFLWRLKDTPHLMTDRGDAQLAKLRAMEKNVRRCQHKM
KAFVRFREISAPEDNRRSFAAWFEPTHHTIEPTAQFFARRFADMDWRILTPDVSVFFENG
NMRFAEDQPKPELPADASETLWVTYFRNIFNPARLKVRAMQSEMPKKYWKNMPEAAAIPD
LIATAPERARQMALAAPTLPPARIGAIQAQQASYESVWDGPPGSLPQAIAGCTRCPLHKT
ATQAVPGEGPIDARLMIVGEQPGDQEDLIGRPFVGPAGQLFDRIAADVGLDRGQVFITNA
VKHFKFVPRGRKRIHQRPNQGEVAHCKWWLDAELRQVAPDLVVAMGATAAAALTGSGKAI
SARRGRIEIGQAGISVLITWHPSYLLRLTDDAAREAATLELAGDLHAALRYETHLQN

BLAST