GenomeNet

>rsl:RPSI07_0638 K02031 peptide/nickel transport system ATP-binding protein | (GenBank) dppD; Dipeptide transport ATP-binding (ABC superfamily) (A)
MTTPATSKPTLVVEGLKTEFTTRGGVARAVDDVSFTVGRGEIMGLVGESGSGKSMTGYSI
MGLIDPPGRVVGGRIELTGRDGVTHDLRTLSAGQMRDMRGNRIAMIFQDPMMTLNPVLRV
DTQMTEAVLAHQRVSRQQAREMAREALAKVGIPSPEERLQAYPHQFSGGMRQRVAIAIAL
LNKPDLIIADEPTTALDVTIQGQILAEVQTLCRESGTALIWITHDLSVVAGLADRVCVMY
AGRIVEQGSVQQVLETPRHPYTFGLIASAPSRNPRGVPLRQIPGMTPSLLALPSGCAFRE
RCAFATEVCKQTPLLESLDDGRALRCFHPVTQRPEEATA

BLAST