GenomeNet

>run:DR864_07135 K00864 glycerol kinase [EC:2.7.1.30] | (GenBank) glpK; glycerol kinase (A)
MSKYVAAIDQGTTSTRCIIFDRQGNIISVGQKEHQQIYPQPGWVEHNPEEIWKNTLEVIA
GARINASISATEIAAVGITNQRETTAVWNRKTGKPYYNALVWQDTRTGDLVNHFAQDGGQ
DRFRAQTGLPLATYFSGLKLKWLLDNVPGLREDAEKGEALFGTMDTFLIWNLTGGPHGGT
HVTDVTNASRTQLMNLHTLAWDSDMLAAFGIPSAMLPFIKSSSEVYGNVVLDVLPNVPIA
GDLGDQHAALVGQTCFEPGQAKNTYGTGCFMLLNTGTELKVSTQGLLTTVAYKFGNQPVN
YALEGSVAIAGALVQWLRDNLGMIEKSSDVETLAKSVEDNGGAYFVPAFSGLYAPYWKAD
ARGVIAGLTRYVTKAHIARAVLEATAYQTLDVMNAMEKDADIELKSLRVDGGMVANETLM
QFQADMLNVPVVCPAVTETTALGAAYAAGLAVGYWENFDDLRQNWGIAHTWNPKMESEQR
AKLYKGWHKAVERSFGWED

BLAST