GenomeNet

>sasa:106587736 K06855 mitogen-activated protein kinase 4/6 [EC:2.7.11.24] | (RefSeq) mitogen-activated protein kinase 6-like (A)
MAEKFESLMNIHGFDLGPRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIILTDPQSVK
HALREIKIIRRLDHDNTVKVFETLGPSGRHLTEDIVSLTEVNSVYIVQEYMETDLCQLLE
RGLLSEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVLREEDRQELHSVIPVFIHGDMSQPHNPLAKLLPDVSPHALDFLQKILTFN
PMDRLTAEEALAHPYMSDYSFPLDEPVSLHPFHIEDEVDDILLMDQGHSHTWDRYHDSQL
SEGDWHLHTHSTLDTDEVQVDPRALSDQTDEEEVQVDPRKYADGDREFLDDPSYGYSSLF
TPERSWPDPDDEHFDLHHENKYCDLECSHTCNYKVVSPSYLDNLIWRDSEVNHYYEPKLI
IDLSNWKEQQSKEKQAQAAGRDKEHKAQKSKCEKNGLVKAQMVLQVEKSPVEKDSQQEKN
QTQTTQQNQGFDFDSFIAGTIKLSLQTEPSDVGLLGDVGLLSEVGVGLLSEVGLLNELNS
SVSQLEAPRSGSMSKTISQEKEEKCLVNFAQVSITVGTAGSGARPAHPWESFGGGERVEE
RRGGCLMDGAGRWDVGKEEQLQKDSSYTSYLDRLFSRKDEGSGETAASAADTPEPEPSDV
GGERERDEGGFLARSGEIMFNMQLDSLALPGFDATTDVPLKSIQASLAPSTVKCSPQIAH
TTYSSFFKHLN

BLAST