GenomeNet

>sbg:SBG_2748 K06282 hydrogenase small subunit [EC:1.12.99.6] | (GenBank) hyb0; hydrogenase-2 small chain protein (A)
MTGDNTLITSHGINRRDFMKLCAALAATMGLSSKAAAEMAESVSNPQRPPVIWIGAQECT
GCTESLLRATHPTVENLVLETISLEYHEVLSAAFGHQVEENKHNALEKYKGQYVLVVDGS
IPLKDNGIYCMVAGEPIVDHIRKAADGAAAIIAIGSCSAWGGVAAAGDNPTGAVSLQEVL
PGKTVINIPGCPPNPHNFLATVAHIITYGTPPKLDAKNRPTFAYGRLIHEHCERRPHFDA
GRFAKEFGDEGHRQGWCLYHLGCKGPETWGNCSTLQFCDVGGVWPVAIGHPCYGCNEEGI
GFHKGIHQLAHVENQTPRSEKPDVNMKEGGHVSAGAIGLLGGVVGLVAGVSVMAVRELGR
QQKKDNADSRGE

BLAST