GenomeNet

>sdt:SPSE_0278 K02031 peptide/nickel transport system ATP-binding protein | (GenBank) oligopeptide ABC superfamily ATP binding cassette transporter, ABC protein (A)
MNKLLNLNNLTVRQGERHVIESLDMTLYASKVNVLIGESGAGKSILIKALLGALPEHFEM
TYDEWHYQGQRVTSLKPYLGKQVGYISQDYTHSFNDHTPIGKQLIGIYRQHYKVSRQEAA
HQVQKALQWVGLDHLDLRKRYRFMLSGGQLERVLIASVMMLEPTLIIADEPTAALDAVTG
QQIMTLLHHLAEAHDVTLWVVTHNLTHVKRFSDYLYVLQHGRIVDHGDDIYFKSANIHPY
SALLFEHRSQLKQGESYD

BLAST