GenomeNet

>sfe:SFxv_0578 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (GenBank) ahpF; Alkyl hydroperoxide reductase, F52a subunit (A)
MMMFKAQEINMLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKV
TFKEDNSLPVRKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLE
QIRHIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMG
VPAVFVNGKEFGQGRMTLTEIVAKIDTGAENRAAEELNKRDAYDVLIVGSGPAGAAAAIY
SARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSA
SKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDG
PLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIIL
NAQTTEVKGDGSKVVGLEYRDRVSGNIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEI
IIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA

BLAST