GenomeNet

>sfu:Sfum_3218 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (GenBank) glutaredoxin (A)
MAVDVIVYTVEECPFCEKAKRFLAEKGIEYKEIPVRPASRQWLEMKEKTGGGTVPQVLVE
GVPVGGYSDLVSLEATGELYRRLGMKDREAAATLYDVIILGAGPAGLSAAIYAIRKLLKT
LVISRDVGGQVTWTADVENYLGFSHVNAGDLVARFEEHVKTFGVERVIGPEVTSVDLTAK
IKRVVTDDGKVYSGKTLIIATGGRHRHMNIEGEHELIAKGISYCSTCDAPLYDGADVAVI
GGGNSALAAALDLIQIANRIYLVSMTPLTGDPLYQEKVQKSEKVEMFLEYVPVRVLGDKA
VRGVEIRSLQSGEVRELTVEGIFVEIGILPNSSLFVDTLATNRRGEILVDLECRTGLAGV
FACGDVTNVPFKQVVVAVGEGAKAALSAYSYLINQ

BLAST