GenomeNet

>sif:Sinf_0850 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (GenBank) pyruvate/2-oxoglutarate dehydrogenase,dihydrolipoamide acetyl transferase E2 subunit (A)
MANEIIMPKLGVDMQEGEILEWKFSEGDVVNEGDILLEIMSDKTNMEIEAENSGVLLKIV
HPAGDVVPVTEVIGYIGAVGENVDDLVGEGQAEQLEPVQEASADFSQPSDAPAIFQKGKI
RATPAARKLAAERGIALDSISGTGENGRIHKDDVAKFAKVRVTPLARKIAADMGLELSGI
AGTGASGKITKDDVLAKAGADKSESSEEVHSVPDGIEVIKMSGMRQAISKGMSKSYFTAP
TFTLDYDIDMTNLLALRKQLIEPIMAKTGYKVTVTDLIGLAVTKALMKEEHRYLNASLIN
DAKAIELHHFVNLGIAVGLPDGLVVPVVHGADKMTLSDFVVASKDVIQKAQAGKLKATDM
SGSTFSITNLGMFGVKSFNPIINQPNSAILGISATVDTPVAIDGQVVIRPIMGLSLTIDH
RLVDGMNGAKFMLDLKALLENPLELLI

BLAST