GenomeNet

>slk:SLUN_36935 K01607 4-carboxymuconolactone decarboxylase [EC:4.1.1.44] | (GenBank) hypothetical protein (A)
MTSRRPMSATTSEGCQMNGTNDGEATPPPTVSRRDRGIAAYARIFALPEQEVPAAFAELV
GPEFAEEALQAAGGAGWWHPALTARDRSIAIITALACQGVADKRLRTHVRLGMRHGLDQD
ALTALAALLAGYIGYPRASITMETIKDEYAHTDRTEP

BLAST