GenomeNet

>sln:SLUG_17290 K00240 succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4] | (GenBank) sdhB; putative succinate dehydrogenase iron-sulfur protein (A)
MTETLSANNTPKDQHADSNQQPQKEKQKTIKLIIKRQDNQDSKPYDEAFEIPYKDNMNVI
ACLMEIRRNPVNAEGKKTTPVIWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRL
EPMSTFPVIRDLQVDRTRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMT
CGVCLEVCPNVTPNNKFVGAQAISQVRLFDLHPTGAMTKDERLDALMGTGGLQECGNSQN
CVNACPKGIPLTTSIAAMNRETTFHMFKSFFGSDHKVE

BLAST