GenomeNet

>slw:BRW62_03955 K01147 exoribonuclease II [EC:3.1.13.1] | (GenBank) RNB domain-containing ribonuclease (A)
MEKGTLIEFRVQNQRRLATIDRPEGKKLWIAMDQHLQSHTLHPRHITFTVPHERFRPQDI
PAFWQQVQSLLDPESLEVAWEIIREEQRTITPQGLAELLFGETTAATCYAAYYLLSEDRF
YFKLKGEVYEPRSVAQVAELKHQHEKEAQRLAEEATFTEHLAQALAGEAVQWSAGDRKRL
EQLERYAIAIETSAQHQGAVELLRQLKRPTQPLGAFQLLVDLGLWSTHENLFLRRSQIQV
EFSAKVLDVAHNCLNSPPTDIDADLRRDLTHLKVYTIDDESTQEIDDGLSVEVVGDRQKL
WIHIADPSRWVMADDVLDHEARRRATTVYLPTGIIPMFPSELATGPMSLVEGRLCCALSF
GILLAESGEVLEYEICPSWIRPTYRLSYDDVDMILEQAVPAEADLLAIAHWGNRRSQWRQ
QRGAIRIDIPEPSIKVAGEEVEISPLRDSPARQLVAEMMILAGEVAADYGLREGIPLPFR
CQSPPELPPDDELRQLPAGVVRDCAIRRCMPRSEMSTQPNPHASLGLDAYCQVTSPIRRY
TDLLAHRQIKAHLRGETPPLTPEQLNELLLRLVSSIQESSLVERQTNRYWCLEYLRRHRD
EVWRGILLRWLRPEENLGLVLLEDLGVELAMRLQRQANLGESLLVRASRVDPRSDQIWLE
EVSEVPSSPAATVTP

BLAST