GenomeNet

>smw:SMWW4_v1c14370 K11208 GST-like protein | (GenBank) yncG; putative glutathione S-transferase (A)
MHDTYTLFGTQGCGSTIVAAALALTAFPWGYEEVDYTQDGPERDRLLALNPLGQVPTLVL
PNDEVMTESAAIILLLHDRAPHAELAPPGGSPLLPRFLRWLLFINAEIYPTFTYADHPQR
WQPQAAGAEQLKNAVMDYRERLLRQLNAAAGASGPWFLGKSFSALDLYVAVMCNWRPGRA
WFRQHCPRLYAIAERVERRPELNALLSAHFDGVASLEP

BLAST