GenomeNet

>sod:Sant_2268 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (GenBank) Alkyl hydroperoxide reductase subunit, FAD/NAD(P)-binding protein (A)
MLDTTMKTQLKAYLEKLTKPVELVATLDEGAKSAEIRGLLTDIADLSDKVSWREDNQLPV
RKPSFRVANPGVDHGPRFAGSPLGHEFTSLVLALLQTGGHPSREAQSLLDQIRQLDGEFH
FETYYSLTCHNCPDVVQALNLMAILNPRIHHTAIDGGAFQNEIQERNIMGVPAVFMNGES
FGQGRMTLSEIVNKIDTGAAARAAQALNQREVYDVLIVGSGPAGAAAAVYSARKGIRTGL
LGERFGGQVLDTVDIENYISVPKTEGARLATSLKAHVDEYDVDVIDVQSASRLIPAAAPG
QPHQIETASGARLTARSLIIATGARWRNMNVPGEELYRTRGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVEHVTLLEFAPAMRADAVLQAKLRSLNNVDILLNAQTLEVTGD
GTKLTGLRYKDRVSHGEHELAVAGIFVQIGLLPNTQWLEGTVERNQTGEILIDAKCETSV
KGIFAAGDCTSVPYKQIIIAAGEGAKASLSAFDYLIRNTPVV

BLAST