GenomeNet

>spj:MGAS2096_Spy1011 K02036 phosphate transport system ATP-binding protein [EC:7.3.2.1] | (GenBank) pstB; Phosphate transport ATP-binding protein pstB (A)
MMTESILQIRDLSVYYNQKKTLKDVSLDLYPNEITALIGPSGSGKSTLLRSINRMNDLNP
EVTITGSIVYNGHNIYSPRTDTVDLRKEIGMVFQQPNPFPMSIYENVVYGLRLKGIRDKS
ILDHAVESSLKGASIWNEVKDRLHDSAVGLSGGQQQRVCIARVLATSPRIILLDEPTSAL
DPISAGKIEETLLLLKKDYTLAIVTRSMQQASRLSDRTGFFLEGDLLECGPTKAMFMNPK
RKETEDYISGKFG

BLAST