GenomeNet

>sre:PTSG_10090 K04515 calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17] | (RefSeq) CAMK/CAMK2 protein kinase (A)
METETSFFDLYDVDLKDKRSVIGKGAFSTVHRCVNKRTGEVCAVKVIALKSLRSSEINKI
KREIGICSSLQHEHIVSMRRAFRDESHFYLVFEYVSGGELFDEIVTRKFYNEKDASACMH
QILSALQHCHSKNIIHRDLKPENLLLASKDPNAPVKITDFGLAVIMEQGPTYFGFAGTPG
YLSPEVIRRVPYDTAVDVWACGVILYILLVGYPPFWEEDHQKLYAQIKNCQYDFPSPEWD
SVTTAAKELIKAMLEPNPKRRPTVQELLQHPWIARRDVPGSVHRQATLEELKKFNARRKL
KGGVNAVIGVSKMMRTMQEATRALTLSAKSKQAATVAEKQDTLVPAGPAKAVLEVNDELL
KAVASGDWDAYTTMVDPNVTCFEPEAAGVLAKGLAFHKFFFDNRSPNADKMKTTLHDPAV
QMFGDTAIVTALRVVQFVADDGPKTTRYEETRVWVKDAAFKFGWKLVHFHRSGAHATPN

BLAST