GenomeNet

>ssc:100157920 K11421 histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43] | (RefSeq) SETDB1; histone-lysine N-methyltransferase SETDB1 isoform X1 (A)
MSSLPGCIGLDAAAAAMESEEIAELQQAVVEELGISMEELRQFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASKAVTNCESLVKDFYSKLGLQYRDSSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLSQMTGELTKDGDLTVGMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDHHPPVDKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKNRFLIFFDDG
YASYVTESELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTSTGTQFKPLEPPQPTASPVPPAPAPPGPPLSPQAGDNESL
ESQLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSETAPVGKPGINQTYRSPLGSTTSA
PTPPAPPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRNEQYRGKNP
LLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFC
LDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFI
NTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECLPTGVY
ECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTD
DFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPE
ESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSEMPSKDSRPPDLGPPHIPV
SPSIPVGSCNPPSSEETPKNKVASWLSCNSVNEGGFADSDSRSSFKTSEGGEGRAGGSRG
EAEKASSSGLGFKDEGDIKQAKKEDPDDRSKMSIVTESSRNYGYNPSPVKIEGLRRPPSK
TSMHQSRRLLAFAQSNPDDILTLSSSTESEGESGTSRKPTAGQTSATAVDSDDIQTISSG
SEGDDFEDKKNMSGPVKRQVAVKSTRGFALKSTHGIAIKSTNMASVEKGESAPVRKNTRQ
FYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGT
ELTWDYNYEVGSVEGKELLCCCGAIECRGRLL

BLAST