GenomeNet

>ssif:AL483_06920 K00208 enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10] | (GenBank) fabI; enoyl-[acyl-carrier-protein] reductase FabI (A)
MFSLEGKTYVIMGIANKRSIAFGVAQALDELGAKLVFTYRKERSKKELDKLVDQLNQKEH
LTYQIDVQSDDEVIDGFKKIGEDVGQIDGVFHSIAFANVEDLRGRFSETSREGFLLAQDI
SSYSLTIVSREAKKLMPEGGSIVTTTYLGGEYAVPNYNVMGVAKASLEANVRYLALDLGQ
DNIRVNAVSAGPIRTLSAKGVGGFNTILKEVEERAPLKRNVDKEEVGKTAAFLLSDLSSG
VTGENIHVDAGFHVIK

BLAST