GenomeNet

>stre:GZL_04181 K02036 phosphate transport system ATP-binding protein [EC:7.3.2.1] | (GenBank) Phosphate transport ATP-binding protein PstB (A)
MIPMAKRIDVSGLNAYYGAHKAIDDISMTIEPRSVTAFIGPSGCGKSTFLRTLNRMHEVT
PGGRVEGKVLLDDENLYGAGVDPVAVRRTVGMVFQRPNPFPTMSIFDNVAAGLRLNGRYR
KSELKDIVERSLKGANLWNEVKDRLNKPGSGLSGGQQQRLCIARAIAVEPQVLLMDEPCS
ALDPISTLAIEDLIGELKERFTIVIVTHNMQQAARVSDRTAFFNLAAVGKPGKLIEIDET
ERIFSNPSVQATEDYISGRFG

BLAST