GenomeNet

>strt:A8713_19410 K07058 membrane protein | (GenBank) hypothetical protein (A)
MDWLKNLPVIGPWLTRLMQTHAWRSYERLDRVKWTRLAAAMTFVSFIALFPLLTLAAAIG
AATLSTRQQHTMESKIAQQFPGLGDQLHITSLAQNAGTVGIIAGAALLFTGMGWVGQMRD
CLRAVWELPDPEKNPVVSKVQDAGILVGFGGAVLITLAVSTVASAAVGWTSRAVGLGEDG
AGSVVLRVIAFAVAVLADFLVLLYVLTLLPGVEPPRHRLVVAALLGAVGFELLKLLLSGY
IQGVAAKSMYGAFGVPVALLLWINFTAKLVLYCSAWTATGSAAEADGDAAGPGTGGADDG
GGDATEGPGGRLRGADGAA

BLAST