GenomeNet

>sulr:B649_10305 K07058 membrane protein | (GenBank) hypothetical protein (A)
MSLKAYLEANISGFALSALSIFPFLLLWSIFFLIYKIAVNADVSIKAAAISSFIVAVVWG
IAKNSFVQYVFYNKTYATMYGSFSALIFFFLWIYVSWIIVIYGMKLCYLINRATQRSETQ
NT

BLAST