GenomeNet

>T30245:26164 K01760 cysteine-S-conjugate beta-lyase [EC:4.4.1.13] | hypothetical protein (A)
DVTAGCAVTNNEDIASEICLLQKNFGGILGVEDAWLILRGMKTMGLRMEKSVENARILTK
FLETQDKIKKVYYPNLTSCKFYDIHTEQASSGGAVFSFEFFEQDDLKTFLKKIKIPIYAI
SLGGVESIISHPATMSHACMSEEERLAQGVTQTLLRFSCGVEDSEDLIEDLKQALNN

BLAST