GenomeNet

>vg:8656648 K19396 Influenza A virus non-structural protein 1 | (RefSeq) NS1, FLUAVH5N1_s8gp2; Influenza A virus (A/goose/Guangdong/1/1996(H5N1)); nonstructural protein 1 (A)
MDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKGRGSTLGLDLRVATME
GKKIVEDILKSETNENLKIAIASSPAPRYITDMSIEEMSREWYMLMPRQKITGGLMVKMD
QAIMDKRIILKANFSVLFDQLETLVSLRAFTESGAIVAEIFPIPSVPGHFTEDVKNAIGI
LIGGLEWNDNSIRASENIQRFAWGIHDENGGPSLPPKQKRYMAKRVESEV

BLAST