GenomeNet

>thas:C6Y53_13905 K00161 pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1] | (GenBank) pdhA; pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha (A)
MAARKSAKKPNISADELKTYYREMLLIRRFEEKAGQLYGMGLIGGFCHLYIGQEAVVVGL
EAAAEEGDKRITSYRDHGHMLACGMDAGGVMAELTGREGGYSKGKGGSMHMFSKEKHFYG
GHGIVGAQVPLGAGLAFADKYLGNGRVTFTYFGDGASNQGQVYETFNMAALWDLPVVFVI
ENNQYAMGTAQKRSTSTPDIYTRGEAFGIPGETVDGMDVLAVKAAGEKAVAHCRAGKGPY
ILEIKTYRYRGHSMSDPAKYRTREEVQKMREERDPIEHVRQMLLTGKHATEDDLKAIDKE
IKDVVNSAADFAKESPEPSVDELWTDIYA

BLAST