GenomeNet

>uah:113262740 K11703 collagen beta-1,O-galactosyltransferase [EC:2.4.1.50] | (RefSeq) COLGALT2; procollagen galactosyltransferase 2 isoform X1 (A)
MAARRAATLACSLLLLSAALLRRGCRARFAAEPDSEHDAEETQVFPESPVQRPTVLVAIL
ARNAAHALPHFLGCLERLDYPKSRMAIWAATDHNVDNTTEILREWLKNVQRFYHYVEWRP
MDEPESYPDEIGPKHWPGSRFAHVMKLRQAALRTAREKWSDYILFIDVDNFLTNPQTLNL
MIAENKTIVAPMLESRGLYSNFWCGITPQGFYKRTPDYLQIREWKRLGCFPVPMVHSTFL
IDLRKEASDKLMFYPPHQDYTWTFDDIIVFAFSSRQAGIQMYLCNREHYGYLPIPLKPQQ
TLQEEIENLVHVQIEAMIDGPPMEPSQFVSVVPKYPDKMGFDEIFMINLKRRKDRRDRML
RTLYEQEIEVKIVEAVDGKALNTSQLKALNIEMLPGYRDPYSSRPLTRGEIGCFLSHYSV
WKEVIDRELEKTLVIEDDVRFEHQFKKKLMKLMDDIDQAQLDWELIYIGRKRMQVKEPEK
AVPNVGNLVEADYSYWTLGYVISLEGAQKLVGADPFGKMLPVDEFLPIMYNKHPVAEYKE
YYESRDLKAFSVEPLLIYPTHYTGQPGYLSDTETSTIWDNETVATDWDRTHSWKSRKQSH
IHRNAKNTEALPSPTSLDAVPSRDEL

BLAST