GenomeNet

>vau:VANGNB10_cII0448c K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] | (GenBank) ddl; D-alanine-D-alanine ligase-like protein (A)
MTQTTILLLCGGGSSEHEVSLVSANYLQAQLEKTEGFQVIRVEMRPDGWYSEKGDLSFLD
TNAATLNTNGVAVNIDFVVPCIHGYPGETGDIQSMLELAGIPYLGCGPEASANSFNKITS
KLWYDALGIPNTPYLFLSENNAQAHQQCKQALEKWGSVFIKAARQGSSVGCYKVTEVSQL
NSAIDAAFSYSEQVLVEKAVKPRELEVAAYQLDGVLYLSKPGEIIAPEDAFYTYEEKYSA
ASHSMTEVQAQNLTREQLEMISDCAARVFTHMKLRHLARIDFFLTPEGNIYLNEVNTFPG
MTPISMFPKMLEHNGHRFHEFLANCVTTSLNQKV

BLAST