GenomeNet

>vcc:FAZ90_10180 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (GenBank) ahpF; alkyl hydroperoxide reductase subunit F (A)
MLDQAMKQQLKAYLENLKTNVQLVLSLDNSDTANKLQDLANDIASLTDKIEVIRNDSAST
RSPIMQVVNQEKGTAIGFAGLPMGHEFTSLVLALLHSGGHPIKLEADVIEQVKELDQELN
VEIFISLSCQNCPEVVQAFNMMSAINPLIKTTMIDGAAFQDEVKSRDIMAVPSVFINGEL
FGQGRMSLAEILNKVDSGAAEKKAANLNQQAPFDVLVVGGGPAGSSAAIYAARKGIRTGV
VADRFGGQVMDTMAIENFISVKATTGPKLVASLEEHVKEYGVEVMTEQRAANIIAAEDTE
DGYIHIELESGATLRARTVITSTGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGLVEHVTVLEFADTLRADQVLIDKANTTPNIEIIKMAQTTRVVG
DGNRVTGLEYKDRNTDELKQIELAGIFVQIGLMPNSEWLKGSKVELSPRGEIEINAHGAT
SMKGVFAAGDVTTVPYKQIIIAMGEGAKASLGAFDHLIRNSAPVKEAETA

BLAST