GenomeNet

>vro:BSZ04_20595 K02036 phosphate transport system ATP-binding protein [EC:7.3.2.1] | (GenBank) phosphate ABC transporter ATP-binding protein (A)
MFNFDNTLGYEPPLDVHNLTDEQTAISIENLNLFYGQAQALHDISMRIPKGRVTAFIGPS
GCGKSTLLRCINRMNDLVEGCKVTGKVRLHGKNVYNPSVDVATLRRRVGMVFQRPNPFPK
SIYENVVYGLRLQGVKTRRTLDDAVERSLRSAALWDEVKDRLHENAFGLSGGQQQRLVIA
RAVAIEPEVLLLDEPTSALDPISTLTIEELINELKTQYTVVIVTHNMQQAARVSDHTAFI
HMGKLIEYSDADSIFTSPMKKQTEDYITGRYG

BLAST