GenomeNet

>vvu:VV2_0502 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (GenBank) ahpF; alkyl hydroperoxide reductase, F subunit (A)
MLDQAIKQQLTQYLTNLKQDVRLVVSLDDSKGSQDILALANEIAELSPLITVVRDDAAST
RKPVMTVTNPEKSTALRFAGLPMGHEFTSLVLALLHSGGHPIKLDAETIEQIAQLDKELD
VEVFISLSCQNCPDVVQAFNMMAAINPKIRATMIDGALFQDEVKQRDILAVPSVFVNGEL
FGQGRMSLTEILNKLDDGAAEKAAASLNDKDPYDVLVVGGGPAGAAAAIYAARKGIRTGI
VAQRLGGQVMDTMAIENFISVKHTEGPKLAANLGEHLKEYGVDIITEQQAEKLMGAQYTE
DGKIHVNLQSGATLKSNSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADTLRADQVLINKANSLPNVDIITMAQTTEVVG
DGKRVTGLKYKDRNTDEIKQLDLAGIFVQIGLVPNTEWLKDSDVELSARGEIEIGSRGET
SLEGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQG

BLAST