GenomeNet

>ypc:BZ23_3561 K01176 alpha-amylase [EC:3.2.1.1] | (GenBank) alpha amylase, catalytic domain protein (A)
MKRLTLPLLLVLSPAAMANWSLQHFPAFTEQDSGIFLSSSALTKGEYPLKFYQDKQCWQP
TGPVKLNQMLSLQPCQENIAIPWRLFRDGQYQARIDTRSGTPTLTLSVTAPVAEAIQVVT
HSCQRWDGNPVTVDVSKTFAEGEIVRDFYSGQTATVSLGKITLRPAPESGGLLLLESAQT
QQAAPFSWQNATVYFALTDRFNNGNPANDHSYGRHGDGMQEIGTFHGGDLAGLTEKLDYL
QQLGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYGLDWTRLDANMGTEQDLRTLVE
QAHKRGIRILFDVVMNHVGYATLADMQNDQFGALYLQGDQQEKTLGKHWSDWTPGSGQTW
HSFNDYINFSDKTAWDNWWGKKWIRTDIGDYDTPGYDDLTMSLAFLPDIKTESTQPSGLP
VFYRNKPDTAAQEIAGATPRDYMTHWLSQWVRDYGIDGFRVDTAKHVEKPAWQQLKQQSI
AALAEWKAAHPEQALDNLPFWMTGEAWGHGVMKSDYYQNGFDAMINFDFQDQANQALACF
SSIESTYNQMAEKLQNFNVLSYLSSHDTRLFFKDDAQQSLAKQQRAGSLLLLAPGAVQIF
YGDESGRKFGPTGSDPLQGTRSDMNWSELSGEKGALLAHWQKVSQFRARHPAIGAGVQQS
QQTANYYAFSRQHQGDKVLVVWVGDKN

BLAST