KEGG   ORTHOLOGY: K13791
Entry
K13791                      KO                                     

Name
ipaH9.8
Definition
invasion plasmid antigen
Pathway
ko05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:ko00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    K13791  ipaH9.8; invasion plasmid antigen
Genes
SFL: CP0226(ipaH9.8)
SFE: SFxv_5076(ipaH9.8)
SSN: SSON_P167(ipaH9.8)
SBO: SBO_P113(ipaH9.8)
SBC: SbBS512_A0253
SDY: SDY_P099(ipaH9.8)
Reference
  Authors
Okuda J, Toyotome T, Kataoka N, Ohno M, Abe H, Shimura Y, Seyedarabi A, Pickersgill R, Sasakawa C
  Title
Shigella effector IpaH9.8 binds to a splicing factor U2AF(35) to modulate host immune responses.
  Journal
Biochem Biophys Res Commun 333:531-9 (2005)
DOI:10.1016/j.bbrc.2005.05.145
  Sequence
[sfl:CP0226]
Reference
  Authors
Rohde JR, Breitkreutz A, Chenal A, Sansonetti PJ, Parsot C
  Title
Type III secretion effectors of the IpaH family are E3 ubiquitin ligases.
  Journal
Cell Host Microbe 1:77-83 (2007)
DOI:10.1016/j.chom.2007.02.002
  Sequence
[sfl:CP0226]
LinkDB

KEGG   Homo sapiens (human): 10318
Entry
10318             CDS       T01001                                 

Gene name
TNIP1, ABIN-1, NAF1, VAN, nip40-1
Definition
(RefSeq) TNFAIP3 interacting protein 1
  KO
K23829  TNFAIP3-interacting protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05131  Shigellosis
Network
nt06139  NLR signaling (viruses and bacteria)
  Element
N00941  Shigella IpaH9.8 to NOD-NFKB signaling pathway
Disease
H01492  Systemic sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    10318 (TNIP1)
SSDB
Motif
Pfam: CC2-LZ Filament FlxA
Other DBs
NCBI-GeneID: 10318
NCBI-ProteinID: NP_001239319
OMIM: 607714
HGNC: 16903
Ensembl: ENSG00000145901
Vega: OTTHUMG00000163722
Pharos: Q15025(Tbio)
UniProt: Q15025 A8K4N4
LinkDB
Position
5q33.1
AA seq 636 aa
MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLR
QKAEELVKDNELLPPPSPSLGSFDPLAELTGKDSNVTASPTAPACPSDKPAPVQKPPSSG
TSSEFEVVTPEEQNSPESSSHANAMALGPLPREDGNLMLHLQRLETTLSVCAEEPDHGQL
FTHLGRMALEFNRLASKVHKNEQRTSILQTLCEQLRKENEALKAKLDKGLEQRDQAAERL
REENLELKKLLMSNGNKEGASGRPGSPKMEGTGKKAVAGQQQASVTAGKVPEVVALGAAE
KKVKMLEQQRSELLEVNKQWDQHFRSMKQQYEQKITELRQKLADLQKQVTDLEAEREQKQ
RDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLN
KALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIFEEDFQRERSDR
ERMNEEKEELKKQVEKLQAQVTLSNAQLKAFKDEEKAREALRQQKRKAKASGERYHVEPH
PEHLCGAYPYAYPPMPAMVPHHGFEDWSQIRYPPPPMAMEHPPPLPNSRLFHLPEYTWRL
PCGGVRNPNQSSQVMDPPTARPTEPESPKNDREGPQ
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggaagggagaggaccgtaccggatctacgaccctgggggcagcgtgccctcaggagag
gcatccgcagcttttgagcgcctagtgaaggagaattcccggctgaaggaaaaaatgcaa
gggataaagatgttaggggagcttttggaagagtcccagatggaagcgaccaggctccgg
cagaaggcagaggagctagtgaaggacaacgagctgctcccaccaccttctccctccttg
ggctccttcgaccccctggctgagctcacaggaaaggactcaaatgtcacagcatctccc
acagcccctgcatgccccagtgacaagccagcaccagtccagaagcctccatccagtggc
acctcctctgaatttgaagtggtcactcctgaggagcagaattcaccagagagcagcagc
catgccaatgcgatggcgctgggccccctgccccgtgaggacggcaacctgatgctgcac
ctgcagcgcctggagaccacgctgagtgtgtgtgccgaggagccggaccacggccagctc
ttcacccacctgggccgcatggccctggagttcaaccgactggcatccaaggtgcacaag
aatgagcagcgcacctccattctgcagaccctgtgtgagcagcttcggaaggagaacgag
gctctgaaggccaagttggataagggcctggaacagcgggatcaggctgccgagaggctg
cgggaggaaaatttggagctcaagaagttgttgatgagcaatggcaacaaagagggtgcg
tctgggcggccaggctcaccgaagatggaagggacaggcaagaaggcagtggctggacag
cagcaggctagtgtgacggcaggtaaggtcccagaggtggtggccttgggcgcagccgag
aagaaggtgaagatgctggagcagcagcgcagtgagctgctggaagtgaacaagcagtgg
gaccagcatttccggtccatgaagcagcagtatgagcagaagatcactgagctgcgtcag
aagctggctgatttgcagaagcaggtgactgacctggaggccgagcgggagcagaagcag
cgtgactttgaccgcaagctcctcctggccaagtccaagattgaaatggaggagaccgac
aaggagcagctgacagcagaggccaaggagctgcgccaaaaggtcaagtacctgcaggat
cagctgagcccactcacccgacagcgtgagtaccaggaaaaggagatccagcggctcaac
aaggccctggaggaagcactgagcatccaaaccccgccatcatctccaccaacagcattt
gggagcccagaaggagcaggggccctcctaaggaaacaggagctggtcacgcagaatgag
ttgctgaaacagcaggtgaagatcttcgaggaggacttccagagggagcgcagtgatcgt
gagcgcatgaatgaggagaaggaagagctgaagaagcaagtggagaagctgcaggcccag
gtcaccctgtcaaatgcccagctaaaagcattcaaagatgaggagaaggcaagagaagcc
ctcagacagcagaagaggaaagcaaaggcctcaggagagcgttaccatgtggagccccac
ccagaacatctctgcggggcctacccctacgcctacccgcccatgccagccatggtgcca
caccatggcttcgaggactggtcccagatccgctacccccctccccccatggccatggag
cacccgcccccactccccaactcgcgcctcttccatctgccggaatacacctggcgtcta
ccctgtggaggggttcgaaatccaaatcagagctcccaagtgatggaccctcccacagcc
aggcctacagaaccagagtctccaaaaaatgaccgtgaggggcctcagtga

DBGET integrated database retrieval system