KEGG   ORTHOLOGY: K19397
Entry
K19397                      KO                                     

Name
PB1F2
Definition
Influenza A virus protein PB1-F2
Pathway
ko05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ko00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    K19397  PB1F2; Influenza A virus protein PB1-F2
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03200 Viral proteins
    K19397  PB1F2; Influenza A virus protein PB1-F2
Viral proteins [BR:ko03200]
 -ssRNA viruses
  Influenza A virus
   K19397  PB1F2; Influenza A virus protein PB1-F2
Other DBs
TC: 1.A.102.1.1
Genes
VG: 23104221(PB1-F2) 3655104(PB1-F2) 3655160(PB1-F2) 3802042(PB1-F2) 3896424(PB1-F2)
Reference
  Authors
Varga ZT, Ramos I, Hai R, Schmolke M, Garcia-Sastre A, Fernandez-Sesma A, Palese P
  Title
The influenza virus protein PB1-F2 inhibits the induction of type I interferon at the level of the MAVS adaptor protein.
  Journal
PLoS Pathog 7:e1002067 (2011)
DOI:10.1371/journal.ppat.1002067
  Sequence
[vg:3802042]
LinkDB

KEGG   Homo sapiens (human): 10241
Entry
10241             CDS       T01001                                 

Gene name
CALCOCO2, NDP52
Definition
(RefSeq) calcium binding and coiled-coil domain 2
  KO
K21348  calcium-binding and coiled-coil domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa05131  Shigellosis
hsa05164  Influenza A
Network
nt06133  RIG-I signaling (viruses)
nt06170  Influenza A virus (IAV)
nt06421  Mitophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N00734  IAV PB1-F2/PB2 to RIG-I-like receptor signaling pathway
N01137  PINK-Parkin-mediated autophagosome formation
N01140  TBK1-mediated autophagosome formation
N01141  Mutation-inactivated TBK1 to TBK1-mediated autophagosome formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    10241 (CALCOCO2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    10241 (CALCOCO2)
  09172 Infectious disease: viral
   05164 Influenza A
    10241 (CALCOCO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10241 (CALCOCO2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    10241 (CALCOCO2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Xenophagy
   Cargo receptors
    10241 (CALCOCO2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    10241 (CALCOCO2)
SSDB
Motif
Pfam: SKICH Zn-C2H2_12 NAD_binding_10 HALZ Crescentin
Other DBs
NCBI-GeneID: 10241
NCBI-ProteinID: NP_005822
OMIM: 604587
HGNC: 29912
Ensembl: ENSG00000136436
Vega: OTTHUMG00000160505
Pharos: Q13137(Tbio)
UniProt: Q13137
LinkDB
Structure
PDB: 

Position
17q21.32
AA seq 446 aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFR
VGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGAS
IPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKK
QEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQ
EKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQ
QELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMGLDFNSLPYQV
PTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCF
NCPICDKIFPATEKQIFEDHVFCHSL
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggaggagaccatcaaagatccccccacatcagctgtcttgctggatcactgtcatttc
tctcaggtcatctttaacagtgtggagaagttctacatccctggaggggacgtcacatgt
cattataccttcacccagcatttcatccctcgtcgaaaggattggattggcatctttaga
gtggggtggaagacaacccgtgagtattacaccttcatgtgggttactttgcccattgac
ctaaacaacaaatcagctaaacagcaggaagtccaattcaaagcttactacctgcccaag
gatgatgagtattaccagttctgctatgtggatgaggatggtgtggtccggggagcaagt
attcctttccaattccgtccagaaaatgaggaagacatcctggttgttaccactcaggga
gaggtggaagagattgagcagcacaacaaggagctttgcaaagaaaaccaggagctgaag
gacagctgtatcagcctccagaagcagaactcagacatgcaggctgagctccaaaagaag
caggaggagctagaaaccctacagagcatcaataagaagttggaactgaaagtgaaagaa
cagaaggactattgggagacagagctgcttcaactgaaagaacaaaaccagaagatgtcc
tcagaaaatgagaagatgggaatcagagtggatcagcttcaggcccagctgtcaactcaa
gagaaagaaatggagaagcttgttcagggagatcaagataagacagagcagttagagcag
ctgaaaaaggaaaatgaccacctctttctcagtttaactgaacagaggaaggaccagaag
aagctcgagcagacagtggagcaaatgaagcagaatgaaactactgcaatgaagaaacaa
caggaattaatggatgaaaactttgacctgtcaaaaagactgagtgagaacgaaattata
tgtaatgctctgcagagacagaaagagagattggaaggagaaaatgatcttttgaagagg
gagaacagcagattgctcagttacatgggtctggattttaattctttgccgtatcaagta
cctacttcagatgaaggaggcgcaagacaaaatccaggacttgcctatggaaacccatat
tctggtatccaagaaagttcttcccccagcccgctctccatcaagaaatgccctatctgc
aaagcagatgatatttgtgatcacaccttggagcaacagcagatgcagcccctttgtttc
aattgtccaatttgtgacaagatcttcccagctacagagaagcagatctttgaagaccac
gtgttctgccactctctctga

DBGET integrated database retrieval system