KEGG   T30241 (Metagenome): 1013
Entry
1013              CDS       T30241                                 

Gene name
coaE
Definition
dephospho-coA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Best hit
fnu:FN1932 (best score: 327.405)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS015062.1013-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_660:2600..3121
AA seq 174 aa
MIIGLTGGIASGKSTVSKYLAEKGFKVYDADKIAKDISEKKSVQEEIISTFGNKILDKNG
NIDRKKLKEIVFENKEKLEKLNDIIHPKVINFYKELKEKNTDEVIIFDVPLLFESGIDKF
CNKILVIISDYEVQLNRIVERDKINRELAEKIIKSQLSNEERIKKADVVIENNS

KEGG   T30241 (Metagenome): 1671
Entry
1671              CDS       T30241                                 

Definition
dephospho-coA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Best hit
pru:PRU_0244 (best score: 98.2117)
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS015062.1671-T1-C
LinkDB
Position
C159949:complement(55..336)
AA seq 93 aa
NLQWLESAILFESGFNRRVKFNHVVCVSAPLEMRVRRIMERDFITRESALQWIDRQMPQE
EIEKRADFVIVNDGRASLETQIDKMFVDFNWEI

KEGG   T30241 (Metagenome): 6794
Entry
6794              CDS       T30241                                 

Gene name
coaE
Definition
dephospho-coA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Best hit
nme:NMB0331 (best score: 53.5286)
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS015062.6794-T1-C
LinkDB
Position
C168254:1737..1808
AA seq 24 aa
MTVWVGLTGGIGSGKSAAAQCFAD

KEGG   T30241 (Metagenome): 7787
Entry
7787              CDS       T30241                                 

Gene name
coaE
Definition
dephospho-coA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Best hit
nme:NMB0331 (best score: 364.385)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS015062.7787-T1-C
LinkDB
Position
C169161:3..581
AA seq 192 aa
AQCFADLGVPRIDADAAAHSLTASDGIALPEIRRLFGDTVFDTQGLLRRDILRKEVFASP
SRKALLESVMLPLIFSEIKKQQETFTDAAYGIVEIPLLTEKRQFISLIRRVLTISAPLEK
RIGRVMARSGLTRGEVAAVISHQASESERLLLADDVLLNDGSLKSLREKTMRLHAFYSGI
FASKPTQGKHNG

KEGG   T30241 (Metagenome): 8604
Entry
8604              CDS       T30241                                 

Gene name
coaE
Definition
dephospho-coA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Best hit
pru:PRU_0244 (best score: 124.02)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS015062.8604-T1-C
LinkDB
Position
C169745:3458..3784
AA seq 109 aa
MKIAITGGIGSGKSFVCERLRKFGIAVYDCDEAAKRLMRTSVDIQKRLSDLIGTEVFTDG
KLQKAALAAFLLQSKHNAQAINDIVHPAVAADFERSGCDYMECAILFDS

DBGET integrated database retrieval system