KEGG   T30241 (Metagenome): 1134
Entry
1134              CDS       T30241                                 

Gene name
ndk
Definition
nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Best hit
nme:NMB1307 (best score: 276.174)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04016  MAPK signaling pathway - plant
Other DBs
HMP: SRS015062.1134-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_683:complement(6639..7064)
AA seq 141 aa
MAIERTISIIKPDAVGKNVIGKIYSRFEENGLKIVAAKMKQLTLKEAQEFYAVHKDRPFY
AGLVEFMTGGPVMIQVLEGENAVLKNRELMGATNPSEAAEGTIRADFATSVSINAVHGSD
SVENAALEIAYFFSQTEICPR

DBGET integrated database retrieval system