KEGG   T30241 (Metagenome): 1557
Entry
1557              CDS       T30241                                 

Definition
ribonucleoside-diphosphate reductase
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Best hit
euu:ADJ67_04710 (best score: 169.859)
Taxonomy
Firmicutes - Clostridia [GN:euu]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.1557-T1-C
LinkDB
Position
C159705:2..325
AA seq 108 aa
HFIDFSHDYRFTYAGLDLLANRYLIHSRQHVILESPQEMYLGIALHLALKEKKHRMEWVK
KFYDMLARHEVTMATPTLSNARKPYHQLSSCFIDTVPDSLDGIYQSIA

KEGG   T30241 (Metagenome): 466
Entry
466               CDS       T30241                                 

Definition
ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Best hit
pmz:HMPREF0659_A7405 (best score: 1434.85)
Taxonomy
Bacteroidetes [GN:pmz]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.466-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_490:3..2615
AA seq 871 aa
FEYFLMLVLFDIVFIFGNFRLQSYEKVFYFGKHLVTSQTHFLRRNLMKASKTYSFDEAFE
TSLRYFDGDELAARVWVNKYAMKDSFGNIYEKSPEDMHWRIANEVARIEKKYKNPISAQD
VFELLDHFRYIIPAGSPMTGIGNNYQIASLSNCFVIGLDGDADSYGAILRIDEEQVQLMK
RRGGVGHDLSHVRPKGSPVNNSALTSTGLVPFMERYSNSTREVAQDGRRGALMLSVSIKH
PDAEAFVDAKMEEGKVTGANVSVKITDSFMEAAVNDKPFVQQFPINAEQPTYSKEISAKK
LWEKIVHNAWKSAEPGVLFWDTIIRESLPDCYADLGFRTVSTNPCGEIPLCPYDSCRLLS
INLYAYVKNPFTKDATFDFDLFRKHAVLAQRIMDDIVDLEMEKIELIMEKVKNDPQNDEV
KLAEYHLWEKIQDKSGKGRRTGVGITAEGDMIAAMGLRYGTEEATKFSVEVHKTLALAAY
RSSVTMAQERGAFAIFDAQREAENPFLLRMKEADEQLYADMMKYGRRNIACLTIAPTGTT
SLMTQTTSGIEPVFMPVYTRRRKVNPNDTDVHVDYVDEVGDSFEEYIVYHKKFLEWMQIN
GLDATKKYSQAEINELVKRSPYYKATANDVDWLMKVRMQGAIQKWVDHSISVTVNLPNNV
DEALVNKLYVEAWRSGCKGCTIYRDGSRSGVMISVSKKDKKKKNENETNKDNDLSTAEEK
HGHICTPPEVVEVRPQVLDCDVVRFQNNKEKWVAFVGLLDGYPYEIFTGLQDDDEGIVLP
KSVTKGKVIKQTNPDGTHRYDFQFENKRGYKTTVEGLSEKFNPEYWNYAKLISGVLRYRM
PIDHVIHLVGSLQLNDESINTWKNGVERALK

KEGG   T30241 (Metagenome): 6843
Entry
6843              CDS       T30241                                 

Definition
hypothetical protein
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Best hit
nmh:NMBH4476_0838 (best score: 78.9517)
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.6843-T1-C
LinkDB
Position
C168306:complement(759..887)
AA seq 42 aa
MNEQDLDLDNLDNLLDDFDGVTVEGGVDSENDDGCEGGACKI

KEGG   T30241 (Metagenome): 8206
Entry
8206              CDS       T30241                                 

Gene name
nrdA
Definition
ribonucleoside-diphosphate reductase, alpha subunit
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Best hit
fnu:FN0102 (best score: 1446.8)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.8206-T1-C
LinkDB
Position
C169485:394..2661
AA seq 755 aa
MAMERRKVINRDNIVEDLNIEKIREKLLRACEGLEVNMVELESNIDSIYEENITTQKIQA
SLINTAVAMTTFEESDWAYVAGRLLMMEAEREVYHSRGFSYGDFSKTIRKMIGLGLYDER
LLSYTEEELHQIAQLIDINRDMVYDYAGANMFVNRYLIKYDGKTYELPQETFMAISMMLA
LNEKEGETRVEIVKEFYNALSLRKLSLATPILANLRIPHGNLSSCFITAIDDNIESIFYN
IDSIARISKNGGGVGVNVSRIRAKGSMVNGYYNASGGVVPWIRIINDTAVAVNQQGRRAG
AVTVALDTWHLDIETFLELQTENGDQRGKAYDIYPQVVCSNLFMKRVKNNETWTLLDPYE
IRKKYGIELCELYGYEFENLYEKIENDPNIKLKKFLSAKELFKSIMKTQLETGMPYIFFK
DRANEVNHNSHMGMIGNGNLCMESFSNFKPTINFIEEEDGNTSIRRSEMGEIHTCNLISI
NLAELSSEELEKHVALAVRALDNTIDLTVTPLKESNKHNLLYRTIGVGAMGLADYLAREY
MIYEESINEINEIFERIALYSIKASALLAKDRGAYKAFKGSKWDQGIFYGKKREWYDTNS
KFKDEWNEVFYLVETNGLRNGELTAIAPNTSTSLLMGSTASVTPTFSRFFIEKNQRGAIP
RTVKHLKDRAWFYPEFKNVNPISYVKIMAKIGSWVTQGVSMEMVFDLNKDIKAKDIYDTL
MIAWEEGCKSVYYIRTIQKNTNNISDKEECESCSG

KEGG   T30241 (Metagenome): 9438
Entry
9438              CDS       T30241                                 

Gene name
nrdA
Definition
ribonucleoside-diphosphate reductase, alpha subunit
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Best hit
nme:NMB1291 (best score: 1518.83)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.9438-T1-C
LinkDB
Position
C170163:complement(3575..5869)
AA seq 764 aa
VEEEAMNTPTDLKVTKRDGRLEAIDLDKIHRVVTWAADGLENVSVSQVELKSHIQFYNGI
RTDDIHETIIKAAADLISEDTPDYQYLAARLAIFHLRKIAYGEYEPPHLYDHVKKLTDAG
KYDRHILEDYSREEFDELNAYIDHERDMSFSYAAVKQLEGKYLVQNRVTRQIYETPQFLY
VLVAMCLFSKYPKEARLGYVKRFYDAVSTFKVSLPTPIMSGVRTPTRQFSSCVLIECDDS
LDSINATTSAIVKYVSQRAGIGINAGRIRGLDSEIRGGEARHTGCIPFFKMFQAAVKSCS
QGGVRGGAATLFYPLWHIEAESLLVLKNNRGVEDNRIRQLDYGVQINRLLYTRLIKGGNI
TLFSPNEVPGLYEAFFADQDEFERLYTKYEQDPDIRKRIIPAADLFSTLMQERAGTGRIY
IQNVDHCNTHSPFDPRVAPVHQSNLCMEIALPTKPLDNINDPNGEIALCTLSAFNLGALN
SLDELEGLADLTVRALDALLDYQGYPVEAARTSTMGRRSLGIGVINYAYYLAKNGVRYSD
GSALGLTHRTFEAIQYYLLKASANLAKEYGACTLFNQTVYSQGKLPIDTYKKDLDAVCGE
PLHYDWESLRAEIVKYGLRNSTLTALMPSETSSQIANATNGIEPPRGLVTVKASKDGILK
QVVPEFETLKNAYETLWQLPGNEGYLKLVGVMQKFVDQSISANTAYDPGKFEGGKVSMKQ
MLKDLLTAYKYGVKTLYYHNTRDGADDTQTDIQDDGCAGGACKI

DBGET integrated database retrieval system