KEGG   T30241 (Metagenome): 1721
Entry
1721              CDS       T30241                                 

Gene name
guaA
Definition
tRNA methyl transferase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
fnu:FN1444 (best score: 217.624)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS015062.1721-T1-C
LinkDB
Position
C160051:complement(3..338)
AA seq 112 aa
IAKAEKNWSMENYIESTVKQIKERVGNKQVILGLSGGVDSSVAAALINKAIGKQLTCIFV
DTGLLRKDEAKQVMEVYAKNFDMNIKCINAEERFLSKLAGVTDPETKRKIIG

KEGG   T30241 (Metagenome): 2835
Entry
2835              CDS       T30241                                 

Gene name
guaA
Definition
GMP synthase (glutamine-hydrolyzing)
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
fnu:FN1444 (best score: 309.301)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS015062.2835-T1-C
LinkDB
Position
C162379:1..453
AA seq 151 aa
EPKGIILSGGPASVYAEGAPTLDIKLFQKNIPILGLCYGMQLITHLHGGKVARADKQEFG
KAELELDDKNHILYKNIPNKTIVWMSHGDHVTEMAPDFKIIAHTDSSIAAIENSDKNIYA
FQYHPEVTHSQHGFDMLKNFVFGIAKAEKNW

KEGG   T30241 (Metagenome): 3596
Entry
3596              CDS       T30241                                 

Gene name
guaA
Definition
GMP synthase (glutamine-hydrolyzing)
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
fnu:FN1444 (best score: 381.719)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS015062.3596-T1-C
LinkDB
Position
C163760:complement(3..581)
AA seq 193 aa
IGKEFVEVFNEEAKKIEGAEFLAQGTIYPDVIESVSVKGPSVTIKSHHNVGGLPEDLKFE
LLEPLRELFKDEVRKVGRELGIPDYMVDRHPFPGPGLGIRILGEVTKEKADILREADAIF
IEELRKADLYNKVSQAFVVLLPVKSVGVMGDERTYEYTAVLRSANTIDFMTATWSHLPYK
FLEKVSNRILNEV

KEGG   T30241 (Metagenome): 3865
Entry
3865              CDS       T30241                                 

Gene name
guaA
Definition
tRNA methyl transferase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
alq:C7Y71_007735 (best score: 337.421)
Taxonomy
Bacteroidetes [GN:alq]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS015062.3865-T1-C
LinkDB
Position
C164222:3..629
AA seq 209 aa
HGDTITAIPSDCKTIASTSDVKFAAYASTTQPLWAVQFHPEVFHSLQGKTLLKNFVVDIC
GSKQEWSPASYVETTVKELKEQLGNDRVILGLSGGVDSSVCATLLNRAIGKNLTCIFVDH
GMLRKNEFTKVMEAYEGLGLNVIGIDASEKFFTDLAGVTDPEQKRKIIGRDFVEVFNAEA
KKITDAKWLAQGTIYPDRIESLSITGMVI

KEGG   T30241 (Metagenome): 4058
Entry
4058              CDS       T30241                                 

Gene name
guaA
Definition
GMP synthase C terminal domain
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
pru:PRU_1678 (best score: 298.516)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS015062.4058-T1-C
LinkDB
Position
C164548:complement(151..672)
AA seq 173 aa
NVGGLPEEMDLKLCEPLQWLFKDEVRRVGYELGMPEHLIKRHPFPGPGLAVRILGDITRE
KVRILQEADDIYIENMHNYVCEDGEVLYDKIWQAGTVLLSTIRSVGVMGDERTYEHPVAL
RAVTSTDAMSADWAQLPYDFMAKVSNEIINKVKGVNRVCYDISSKPPATIEWE

KEGG   T30241 (Metagenome): 4275
Entry
4275              CDS       T30241                                 

Gene name
guaA
Definition
GMP synthase (glutamine-hydrolyzing)
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
fnu:FN1444 (best score: 104.375)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS015062.4275-T1-C
LinkDB
Position
C164944:578..733
AA seq 52 aa
MKKGGIVILDFGSQYNQLIARRVREMGVYAEVVPFHEDVDKILAKEPKGIIL

KEGG   T30241 (Metagenome): 5074
Entry
5074              CDS       T30241                                 

Gene name
guaA
Definition
GMP synthase (glutamine-hydrolyzing)
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
fnu:FN1444 (best score: 59.3066)
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS015062.5074-T1-C
LinkDB
Position
C166124:3..89
AA seq 28 aa
NRILNEVKGINRLAYDISSKPPATIEWE

KEGG   T30241 (Metagenome): 6218
Entry
6218              CDS       T30241                                 

Gene name
guaA
Definition
GMP synthase (glutamine-hydrolyzing), C-terminal domain protein
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
pru:PRU_1678 (best score: 241.506)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS015062.6218-T1-C
LinkDB
Position
C167638:1068..1469
AA seq 134 aa
MQKIIILDFGSQTTQLIGRRLRELDTFCEILPYNKFPKDDPSVIGVILSGSPYSVHDPEA
FQVDLSQFVGKVPVLGICYGAQYISHKNGGKVEQTGTREYGRANLATVDTDNPLFRGFDK
NSQVWMSHGDTITA

KEGG   T30241 (Metagenome): 9120
Entry
9120              CDS       T30241                                 

Gene name
guaA
Definition
tRNA methyl transferase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
nme:NMB1920 (best score: 1049.65)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS015062.9120-T1-C
LinkDB
Position
C170033:2795..4360
AA seq 521 aa
MTQDKILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVY
ESDYQADTGIFDLGIPVLGICYGMQFMAHHLGGEVQPGNQREFGYAQVKTIDSELTRGIQ
DGEPNTLDVWMSHGDKVSKLPDGFAVIGNTPSCPIAMMENAEKQFYGIQFHPEVTHTKQG
RALLNRFVLDICGAQPGWTMPNYIEEAVAKIREQVGSDEVILGLSGGVDSSVAAALIHRA
IGDQLTCVFVDHGLLRLNEGKMVMDMFARNLGVKVIHVDAEGQFMAKLAGVTDPEKKRKI
IGAEFIEVFDAEEKKLTNAKWLAQGTIYPDVIESAGAKTKKAHAIKSHHNVGGLPENMKL
KLLEPLRDLFKDEVRELGVALGLPREMVYRHPFPGPGLGVRILGEVKKEYADLLRQADDI
FIQELRNTTDENGTSWYDLTSQAFAVFLPVKSVGVMGDGRTYDYVIALRAVITSDFMTAH
WAELPYSLLGKVSNRIINEVKGINRVVYDVSGKPPATIEWE

DBGET integrated database retrieval system