KEGG   T30241 (Metagenome): 1891
Entry
1891              CDS       T30241                                 

Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
fnu:FN1220 (best score: 219.164)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015062.1891-T1-C
LinkDB
Position
C160424:1..351
AA seq 117 aa
GGSFSGTAKKLKEKLPNIKTFPVEPASSPLLSKGYIGPHKIQGMGMSIGGIPAVYDGSLA
DGILTCEDDDAFKMMRELSFKEGILAGISTGATLKAALDYSKKNANKGLRIVVLSTD

KEGG   T30241 (Metagenome): 6318
Entry
6318              CDS       T30241                                 

Definition
cysteine synthase/cystathionine beta-synthase family protein
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
fnu:FN1055 (best score: 610.142)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015062.6318-T1-C
LinkDB
Position
C167742:98..1108
AA seq 336 aa
MGQEKMKYLENLVGKTPMLELIFDYKGEERRIFVKNESYNLTGSIKDRMAFYTLKKAYEK
GEIKKGAPIVEATSGNTGIAFSAMGAILGHPVIIYMPDWMSEERKSLIRSFGAKIVLVSR
EEGGFLGSIEKTKEFAKNNPGTYLPSQFSNPYNSEAHYYGIGLEIVNEIKSLNLNIDGFV
AGVGTGGTVMGIGQRIKEDFPNAKISPLEPLNSPTLSTGYKVAKHRIEGISDEFIPDLVK
LDKLDEVVSVDDGDAIIMAQKLAKCGLGVGISSGANFIGALMLQNKLGKDSVIVTVFPDD
NKKYLSTDLMREERIKEHFLSKDITLKGIKNVLRIF

KEGG   T30241 (Metagenome): 651
Entry
651               CDS       T30241                                 

Gene name
cysK
Definition
cysteine synthase A
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
nme:NMB0763 (best score: 557.37)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015062.651-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_568:7088..8068
AA seq 326 aa
MGIAPYCRNLIIQEQKMKIANSITELIGNTPLVKLNRLTEGLKAEVAVKLEFFNPGSSVK
DRIAEAMIEGAEKAGKINKNTVIVEATSGNTGVGLAMVCAARGYKLAITMPESMSKERKM
LLRAFGAELILTPAAEGMAGAIAKAKSLVDAHPDTYFMPRQFDNEANPEVHRKTTAEEIW
RDTDGKVDVFVAGVGTGGTITGVGEVLKKYKPEVKVVAVEPEASPVLSGGEKGPHPIQGI
GAGFIPTVLNTKIYDSITKVSNEAAFETARAIAEKEGILVGISSGAAVWSALQLAKQPEN
EGKLIVVLLPSYGERYLSTPLFADLA

DBGET integrated database retrieval system