KEGG   T30241 (Metagenome): 2018
Entry
2018              CDS       T30241                                 

Definition
pyruvate kinase, alpha/beta domain protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
pru:PRU_0684 (best score: 152.14)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS015062.2018-T1-C
LinkDB
Position
C160688:1..363
AA seq 121 aa
SETGQTARNLAAFRGPVPVLAICYNEKTQRWLNLSYGVIPIYQHEEVSSQYMFFAALRML
RQKGYIKDEDKVAYLSGSFGEGGGTSFLEINKVGEVFNENYQFHLPETSGREIAKERKNK
K

KEGG   T30241 (Metagenome): 5816
Entry
5816              CDS       T30241                                 

Gene name
pyk
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
fnu:FN1765 (best score: 640.573)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS015062.5816-T1-C
LinkDB
Position
C167150:238..1266
AA seq 343 aa
VSSLKKTKIVCTIGPVTESVETLKELLNRGMNVMRLNFSHGDYEEHGIRIKNFRQAMSET
GIRGGLLLDTKGPEIRTMTLKDGKDVSIKAGQKFTFTTDQSVVGDNERVAVTYENFAKDL
KVGNRVLVDDGLLELDVTEIKGNEVICVARNSGDLGQKKGINLPNVSVNLPALSEKDIED
LKFGCQNNVDFIAASFIRKADDVRQVRKVLKENGGERIQIISKIESQEGLDNFDEILAES
DGIMVARGDLGVEIPVEEVPCAQKMMIKKCNRAGKVVITATQMLDSMIKNPRPTRAEAND
VANAIFDGTDAIMLSGETAKGKYPLAAVEVMNKIAKKVDATIP

KEGG   T30241 (Metagenome): 585
Entry
585               CDS       T30241                                 

Definition
pyruvate kinase, alpha/beta domain protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
fnu:FN1765 (best score: 245.743)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS015062.585-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_546:1..417
AA seq 138 aa
VDATIPAFYVDGVINKHDITSAVAEGSADISGRLNAKLIVVGTESGRAARDMRRYFPKAN
ILAITNNEKTANQLVLSRGVISYVDASPKTLEEFFILAEVIAKKLNLVENNDIIIATCGE
SVFIQGTTNSIKVIQVKA

KEGG   T30241 (Metagenome): 6508
Entry
6508              CDS       T30241                                 

Gene name
pyk
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
nme:NMB0089 (best score: 908.672)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS015062.6508-T1-C
LinkDB
Position
C167972:complement(193..1635)
AA seq 480 aa
ISHNTKIVATLGPGSNNVELLEDMIRVGGLNVVRFNFSHGTPEFHQENARIVREAAKRAG
QEIAIIADLQGPKIRVGKIAGGGIELNKGETLVLDAALEGEGTREAVGLDYRDLPDDVAA
GDVLWLDDGLLTLTVESVEGSRIITRVENSHVLKSNKGINKRGGGLSAGALTEKDFRDLK
TAIAIGCDYLAISFVKSAEDLHIARAKVEEEMKGSTAVRPGLVSKIERVEAIENLDEIIL
AGDGIMVARGDLAVEVGHAAVPALQKRMIRRARELRRFSITATQMMESMITNPVPTRAEV
SDVANAVLDGTDAVMCSAETAVGAYPFETVSQMAIICAAAEKEQDSLNGVAEQAEYPEAV
STNLAVAGGAVSVARAVHAKAIVALTESGSTAFEISRHNITLPIFALTPSVSAQRRMAMY
RGVRPLILATSTDHDTALNEVETMLVEHNILHSGDQYIITSGSQMRESGSTNTLEVLRVK

KEGG   T30241 (Metagenome): 7983
Entry
7983              CDS       T30241                                 

Gene name
pyk
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
pru:PRU_0684 (best score: 661.373)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS015062.7983-T1-C
LinkDB
Position
C169309:complement(227..1585)
AA seq 452 aa
MNVVRMNTAHASEEGIRKIVENTRAVSPHIALLIDTKGPEIRTTSVAEPIKYKTGDIVKV
FGRPDIESTHDIVNLSYKDIANDVKVGDHLLFDDGALDMEIIEIVGPMLVAKVMNDGELG
SRKSVNVPGAHIDLPALTEKDIANIKLAIDLDIDFIAHSFVRSAADVKAVQDLLDEYNSD
IKIISKIENQEGVDNIDEIIDASYGIMIARGDLGIEVPIEQIPGIQRSIIRKCISKRAPV
IVATQMLHTMINNPRPTRAEVTDIANAIYSYTDALMLSGETASGKYPIEACRTMATIAER
AEKDAHREGFLHIPLSDNMEQREFLAKSAIEATEHLGVKGIITDGDTGKTARNLAAFRGP
NPVLAICYHDKLQRWLNLSYGLLPVYQQEKKSKHELFTAALRMLRQRGYIAPSDKIAYIS
GELGKGGVTTFLEINTVSAVFEDSYKAHMRDK

DBGET integrated database retrieval system