KEGG   T30241 (Metagenome): 2283
Entry
2283              CDS       T30241                                 

Definition
ribonucleoside-diphosphate reductase, beta subunit
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Best hit
fnu:FN0103 (best score: 253.447)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.2283-T1-C
LinkDB
Position
C161246:complement(12..389)
AA seq 125 aa
SHVVLFRSMVKEIKNDFPNFFSAETIYSMFKTAVEQEITWTEHIIGNRVLGITSQTTEAY
TKWLANERLKSLGLEPLFSDFTKNPYKHLERFADTEGEGNVKSNFFEGTVTSYNMSSSID
GWEDF

KEGG   T30241 (Metagenome): 8207
Entry
8207              CDS       T30241                                 

Gene name
FNV0597
Definition
ribonucleoside-diphosphate reductase, beta subunit
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Best hit
fnu:FN0103 (best score: 370.548)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.8207-T1-C
LinkDB
Position
C169485:2642..3199
AA seq 186 aa
VKVAVDRKKLFNPEGDDTLNARKIIKGNSTNLFNLNNVRYQWANQLYRTMMANFWIPEKV
DLTQDKNDYENLTVPEREAYDGILSFLIFLDSIQTNNIPNISDHVTAPEVNLLLAIQTFQ
EAIHSQSYQYIIESILPKQSRDLIYDKWRDDKVLFERNSFIAKIYQDFIDELSDENFAKV
IIANYL

KEGG   T30241 (Metagenome): 9435
Entry
9435              CDS       T30241                                 

Definition
ribonucleoside diphosphate reductase I beta chain
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Best hit
nme:NMB1288 (best score: 755.747)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.9435-T1-C
LinkDB
Position
C170163:complement(130..1263)
AA seq 377 aa
MSYSTFPKTKNDALNEPMFFGQPVNVARYDQQKYEVFEKLIEKQLSFFWRPEEIDVSRDR
IDYANLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIETWSFSETIHS
RSYTHIIRNIVNDPSVVFDDIVENEYITARAEDIACYYDDLIEYTQYYNLLGEGVHNVGG
KPITVSLRGLKKKLYLCLMCVNVLEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEA
LHLTGTQHMLNLMRSGVDDSEMAEIAAELQDECFQLFKKAAEQEKEWAAYLFKDGSMIGL
NKEILSQYVEYITNLRMQAVGLPAGFEGANQNPIPWINAWLSSDNVQVAPQEVEISSYLI
GQIDSEVNTDDLGDFEL

DBGET integrated database retrieval system