KEGG   T30241 (Metagenome): 2393
Entry
2393              CDS       T30241                                 

Definition
glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
fpr:FP2_02530 (best score: 206.453)
Taxonomy
Firmicutes - Clostridia [GN:fpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS015062.2393-T1-C
LinkDB
Position
C161474:3..344
AA seq 113 aa
LNGKLIGSAQRVPTPTGSTTILVAVVKGKDVTVEGINAAMKSAATESFGYNEDQIVSSDI
IGMRFGSLFDATQTMVSKIDDDTYQVQVVSWYDNENSYTSQMVRTIKYFAELK

KEGG   T30241 (Metagenome): 5987
Entry
5987              CDS       T30241                                 

Gene name
gap
Definition
glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
nme:NMB0207 (best score: 666.766)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS015062.5987-T1-C
LinkDB
Position
C167350:complement(131..1342)
AA seq 403 aa
LKPLQTAFYQALRPPHPCRPHLTAHPSGRAVFNKILITRHYKFAIIRPENLPNPSTKERT
MGIKVAINGYGRIGRQVLRAIYDYQIQDQLQIVAVNASGSLETNAHLTKFDTVHGRFEAD
VSHDGGNLIVNGDKIPFFSTRNPAELPWKELGVDLVMECTGAFTSKEKAKVHLESGAKKV
LISAPGGDDVDATVVYGVNDSVLTADMTVVSNASCTTNCLSPVAKVLSESVGIVKGAMTT
IHALTNDQTVTDVRHKDLRRARSGVENMIPTKTGAAKAVGLVLPELKGKLDGLAIRVPTI
NVSLVDLSFQAARDTTVEEINALMKAASEAGALKGVLGYNTLPLVSMDFNHTTEASHFDA
TLTKVVDGNMIKVFAWYDNEWGFSCQMLNTARRMFGLEVRPLK

KEGG   T30241 (Metagenome): 9580
Entry
9580              CDS       T30241                                 

Gene name
gap
Definition
glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
nme:NMB2159 (best score: 653.669)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS015062.9580-T1-C
LinkDB
Position
C170215:7228..8232
AA seq 334 aa
MSIKVAINGFGRIGRLALRQIEKAHDIEVVAVNDLTPAEMLLHLFKYDSTQGRFQGTAEL
KDDAIVVNGKEIKVFANPNPEELPWGELGVDVVLECTGFFTNKTKAEAHIRAGARKVVIS
APGGNDVKTVVYGVNQDILDGSETVISAASCTTNCLAPMAAVLQKEFGVVEGLMTTIHAY
TGDQNTLDAPHRKGDLRRARAAALNIVPNSTGAAKAIGLVIPELNGKLDGSAQRVPVATG
SLTELVSILERPVTKEEINAAMKAAASESYGYNEDQIVSSDVVGIEYGSLFDATQTRVMT
VGGKQLVKTVAWYDNEMSYTCQLVRTLEYFAGKI

KEGG   T30241 (Metagenome): 4217
Entry
4217              CDS       T30241                                 

Gene name
FNV1630
Definition
glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
fnu:FN0652 (best score: 446.817)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS015062.4217-T1-C
LinkDB
Position
C164840:1..702
AA seq 233 aa
KEKAEAHIKAGAKKVVISAPATGDLKTIVYNVNDNVLDGTETVISGASCTTNCLAPMAKV
LNDKFGIIEGLMTTIHAYTNDQNTLDAPHKKGDLRRARAAAENIVPNTTGAAKAIGLVIP
ELKGKLDGAAQRVPVITGSITELVTVLGKDVTVDEVNAAMKAASNESFGYTEEPLVSSDI
IGISFGSLFDATQTKVLTVDGKQLVKTVAWYDNEMSYTSQLIRTLKKFVEISK

KEGG   T30241 (Metagenome): 6915
Entry
6915              CDS       T30241                                 

Gene name
gap
Definition
glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Best hit
bvs:BARVI_06580 (best score: 594.349)
Taxonomy
Bacteroidetes [GN:bvs]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
05010  Alzheimer disease
05130  Pathogenic Escherichia coli infection
05132  Salmonella infection
Other DBs
HMP: SRS015062.6915-T1-C
LinkDB
Position
C168386:complement(106..1125)
AA seq 339 aa
MIKIGINGFGRIGRFVFRASLEEANAKDVVVVGINDLCPVDYLAYMLKYDTMHGIFNGTI
EADVEKSQLIVNGNVIRVTAERNPADLKWDEIGAEYVVESTGLFLTKEKSQAHIEAGAKY
VVMSAPSKDDTPMFVCGVNHEKYVKGTQFVSNASCTTNCLAPIAKVLNDKFGITDGLMTT
VHSTTATQKTVDGPSLKDWRGGRAASGNIIPSSTGAAKAVGKVIPELNGKLTGMSMRVPT
LDVSVVDLTVNLAKPAKYEEICAAMKEASEGELKGILGYTEDAVVSSDFLGDPRTSIFDA
KAGIALTDTFVKVVSWYDNEIGYSHKVVELIKHMAKVNG

DBGET integrated database retrieval system