KEGG   T30241 (Metagenome): 3102
Entry
3102              CDS       T30241                                 

Definition
hypothetical protein
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Best hit
pmic:NW74_05165 (best score: 259.996)
Taxonomy
Firmicutes - Others [GN:pmic]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00260  Glycine, serine and threonine metabolism
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.3102-T1-C
LinkDB
Position
C162864:3..491
AA seq 162 aa
VITTIAYIGDEGDVIPETASAPAKEEIKEEVKAQVEEKVVEVKAETKKELKDGEYDVVVI
GGGPAGYYSAIKAAQKGAKVAIAENNKFGGTCLNRGCIPTKTYLQNVEDIERIKVSSKRG
IILENDNATVDVAKALKFKNSIVKKLTAGVEFLLKSNSPMNE

KEGG   T30241 (Metagenome): 9076
Entry
9076              CDS       T30241                                 

Gene name
lpdA
Definition
dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Best hit
alq:C7Y71_001015 (best score: 370.548)
Taxonomy
Bacteroidetes [GN:alq]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00260  Glycine, serine and threonine metabolism
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.9076-T1-C
LinkDB
Position
C170009:3776..4966
AA seq 397 aa
MEKTDLIIIGAGPGGYHTAVHAAKDGLKVTIIEKRNPGGTCLNEGCIPTKSFAHDADLYR
NPLLSCVGGGSVNFARIQERKNNVIAQLREGVKGLMSMPGITYIEGEAKFVDKKVIEVNG
TQMTADNIIIATGSHARLLPFIPAFDTPEGEPLKDKVMTSTELLDIDHVPQTMAIIGAGV
IGLELASAFETFGSSVTVIEFLKECLPTIDSDIAKRLRKTLEKRGINFNMNSGVKSIVAT
DDKKQAIVTFEQKGQEKQVVADVVLVATGRAANVEGLGLEAAGINCAKQGIETNEHYETN
VPGVYAVGDVNGKQMLAHAASFQGTHVINRILGKEDKIRFDIMPAAVFTYPEAGSVGLSE
DACKKEGISYTVKKGFYRSNGKALAMEETEGMVKVMA

KEGG   T30241 (Metagenome): 991
Entry
991               CDS       T30241                                 

Gene name
lpdA
Definition
dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Best hit
nme:NMB1344 (best score: 966.066)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00260  Glycine, serine and threonine metabolism
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.991-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_656:complement(3..1610)
AA seq 536 aa
MALVELKVPDIGGHENVDIIAVEVNVGDTIAVDDTLITLETDKATMDVPAEVAGVVKEVK
VKVGDKISEGGLIVVVEAEGTAAAPKAEAAAASAQEAPKAAAPAPQAAQFGGSADAEYDV
VVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGVCLNVGCIPSKALLHNAAVIDEVRHL
AANGIKYPEPELDIDMLRAYKDGVVSRLTGGLAGMAKSRKVDVIQGDGQFLDPHHLEVSL
TAGDAYEQAATTGEKKIVAFKNCIIAAGSRVTKLPFIPEDPRIIDSSGALALKEVPGKLL
IIGGGIIGLEMGTVYSTLGSRLDVVEMMDGLMQGADRDLVKVWQKQNEYRFDNIMINTKT
VAVEPKEDGVYVTFEGANAPKEPQRYDAVLVAAGRVPNGKLISAEKAGVAVTDRGFIEVD
KQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENCAGHKAYFDARVIPGVAYTSPEVA
WVGETELSAKASGRKITKANFPWAASGRAIANGCDNGFTKLIFDAETGRIIGGGIV

KEGG   T30241 (Metagenome): 8868
Entry
8868              CDS       T30241                                 

Gene name
lpdA
Definition
dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Best hit
nme:NMB0957 (best score: 934.48)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00260  Glycine, serine and threonine metabolism
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.8868-T1-C
LinkDB
Position
C169905:complement(2737..4170)
AA seq 477 aa
MSQYDVVVIGAGPGGYVAAIRAAQLGFKTACVDAGVNKAGNAPALGGTCLNVGCIPSKAL
LQSSEHFHAAQHDFAEHGITVGDVKFDAAKMIERKDAIVTKLTGGVKFLFQKNKVTSLFG
TASFAGKNGDAYQIEVDNKGEKTVIEAKHVIVATGSVPRPLPQVAIDNVNVLDNEGALNL
TEVPAKLGVIGSGVIGLEMGSVWNRVGAEVTILEAAPTFLAAADQQIAKEAFKYFTKEQG
LSIELGVKIGDIKSEGKGVSVAYETAAGEAKTEVFDKLIVAIGRIPNTKGLNAEAVGLEK
DERGFIKVDGECRTNLPNVWAIGDVVRGPMLAHKASDEGVAVAERIAGQKPHIDFNNVPF
VIYTDPEIAWVGKTEEQLKAEGVEYKKGTSGFGANGRALAMGKAKGTVKVLADAKTDRIL
GVHMIGPVVSELVTEGVTALEFFASSEDIARIIHAHPTLSEVVHEAALAADKRALHG

KEGG   T30241 (Metagenome): 5966
Entry
5966              CDS       T30241                                 

Gene name
lpdA
Definition
dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Best hit
pru:PRU_2044 (best score: 71.2478)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00260  Glycine, serine and threonine metabolism
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.5966-T1-C
LinkDB
Position
C167328:2..157
AA seq 51 aa
KILGCHVFGAHSADITQEVAVLMNNDATLSDLADMIHIHPTIGEVLYETII

KEGG   T30241 (Metagenome): 1034
Entry
1034              CDS       T30241                                 

Gene name
lpdA2
Definition
putative pyridine nucleotide-disulfide oxidoreductase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Best hit
nme:NMB0947 (best score: 915.605)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00260  Glycine, serine and threonine metabolism
00280  Valine, leucine and isoleucine degradation
00310  Lysine degradation
00380  Tryptophan metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.1034-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_664:5140..6609
AA seq 489 aa
MPSETDMFCVGNVSDENGRTKIMKKIQADVVVIGGGTAGMGAFRNARLHSDNVYLIENNV
FGTTCARVGCMPSKLLIAAAEARHHALHTDPFGVHLDKDSIVVNGEEVMQRVKSERDRFV
GFVVADVEEWPADKRIMGSAKFIDEHTVQIDEHTQITAKSFVIATGSRPVILPQWQSLGN
RLIINDDVFSWDTLPKRVAVFGPGVIGLELGQALHRLGVKVEIFGLGGIIGGISDPVVSD
EAKAVFGEELKLHLDAKTEVKLDADGNVEVHWEQDGEKGVFVAEYMLAAVGRRPNVDNIG
LENINIEKDARGVPVADPLTMQTSIPHIFIAGDASNQLPLLHEAADQGKIAGDNAGRYPN
IGGGLRRSTIGVVFTSPQIGFVGLKYAQVAAQYQADEFVIGEVSFKNQGRSRVMLVNKGH
MRLYAEKATGRFIGAEIVGPAAEHLAHLLAWAHQMKMTVPQMLDMPFYHPVIEEGLRTAL
RDADAKLKA

DBGET integrated database retrieval system