KEGG   T30241 (Metagenome): 336
Entry
336               CDS       T30241                                 

Definition
2-hydroxyglutarate dehydrogenase
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Best hit
fnu:FN0487 (best score: 144.436)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS015062.336-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_428:complement(233..475)
AA seq 80 aa
MKVLFYGVREVEVPLFHELNKKFGYDLELIPDYLNSKETAEKAKGFECVVLRGNCFATKE
VLDMYKSYGVKYLXXILQMQ

KEGG   T30241 (Metagenome): 7106
Entry
7106              CDS       T30241                                 

Gene name
FNV1748
Definition
D-lactate dehydrogenase
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Best hit
fnu:FN0511 (best score: 79.3369)
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS015062.7106-T1-C
LinkDB
Position
C168561:3..134
AA seq 43 aa
NVLITSHQAYFTKEAVDAITVTTLNNIRDFIEGKPLVNEVLQN

KEGG   T30241 (Metagenome): 3838
Entry
3838              CDS       T30241                                 

Gene name
pdxB
Definition
2-hydroxyglutarate dehydrogenase
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Best hit
fnu:FN0487 (best score: 281.182)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS015062.3838-T1-C
LinkDB
Position
C164178:1..474
AA seq 157 aa
KTGIDDIVKQVSMEELIAKSDIITLHAPFIKENGKIVTKEFLSKMKENSILINTARGELM
DLEAVVNALESGHLAAAGIDTIEGEVNYFFKNFSNDEAKFRLEYPLFNRLLDLYPRVLVT
PHVGSYTDEAASNMIETSLENLKEYLDTGACKNDIKA

KEGG   T30241 (Metagenome): 703
Entry
703               CDS       T30241                                 

Gene name
ahcY
Definition
S-adenosyl-L-homocysteine hydrolase, NAD binding domain
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Best hit
fnu:FN0511 (best score: 526.939)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS015062.703-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_586:complement(1..879)
AA seq 293 aa
MEKTKIIFFDIKDYDKEFFKKYEKDYNFEMTFLKVRLTEETANLTKGYDVVCGFANDNIN
KETIDIMAKNGIKLLAMRCAGFNNVSLKDIHNRFKVVRVPAYSPHAIAEYTVGLILAVNR
KIHKAYVRTREGNFSINGLMGFDLDGKTVGIIGTGKIGQILIKILKGFDMKVIAYDLFPN
QKVADELGFEYVSLDELYAKSDIISLNCPLTKDTKYMINRRSMLKMKDGVILVNTGRGQL
IDSADLVEALKDKKIGAVALDVYEEEENYFFEDKSNQVIEDDILGRLLSFYNV

KEGG   T30241 (Metagenome): 9125
Entry
9125              CDS       T30241                                 

Gene name
ldhA
Definition
D-lactate dehydrogenase
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Best hit
nme:NMB1685 (best score: 658.677)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS015062.9125-T1-C
LinkDB
Position
C170037:complement(3772..4770)
AA seq 332 aa
MKIAIYGTKSYDREHFTRANRHFGFELEFFDFMLDVKTAKMAEGAEAVCIFVNDDGSRPV
LEKLAQIGVKTVALRCAGFNNVDLKAAEELGLKVVRVPAYSPESVAEHTVGLMLTLNRRI
HKAYQRTRDANFSLEGLTGFNMYGKTAGVIGTGKIGIATMRILKGFGMNLLAYDPFCNPE
AEKLGGRYVDLDELYARSDIITLHCPSTPENHYMLNEAAFDKMKDGVMIINTSRGGLIDS
SAAIEALKRRKIGALGMDVYENERELFFEDKSNDVITDDVFRRLSSCHNVLFTGHQAFLT
EEALGNISEVTLSNIREVGQTGDCGNAVRADG

KEGG   T30241 (Metagenome): 335
Entry
335               CDS       T30241                                 

Gene name
pdxB
Definition
2-hydroxyglutarate dehydrogenase
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Best hit
fnu:FN0487 (best score: 126.331)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS015062.335-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_428:complement(3..209)
AA seq 69 aa
MSLLRHLPYTAQKFNKRDFTVDKNMFSREVRNCTVGVVGLGRIGFTAAKLFKGLGANVIG
YDMFSKTGI

DBGET integrated database retrieval system