KEGG   T30241 (Metagenome): 3880
Entry
3880              CDS       T30241                                 

Gene name
lysC
Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
nme:NMB1498 (best score: 323.939)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015062.3880-T1-C
LinkDB
Position
C164256:complement(131..634)
AA seq 167 aa
TLITFEEDDNMERAAVTGIAFDKNQARINVRGVPDKPGVAYQILGAVADANIEVDMIIQN
VGSEGTTDFSFTVPRGDYKQTLEILSERQDSIGAASIDGDDTVCKVSAVGLGMRSHVGVA
AKIFRTLAEEGINIQMISTSEIKVSVLIDEKYMELATRVLHKAFNLG

KEGG   T30241 (Metagenome): 676
Entry
676               CDS       T30241                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
nme:NMB1498 (best score: 290.426)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015062.676-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_577:complement(2..499)
AA seq 166 aa
MALIVHKYGGTSVGSPERIKNVAKRVAKARAEGHDIVVVVSAMSGETNRLVALAHEMQEH
PDPRELDVVLSTGEQVTIGLLAMALKDIGVDAKSYTGWQVALKTDTAHTKARIESIDDEK
MRADLTAGKVVIVAGFQGISSEGDISTLGRGGSDTSAVALAAALKA

KEGG   T30241 (Metagenome): 8953
Entry
8953              CDS       T30241                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
pru:PRU_0480 (best score: 673.7)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015062.8953-T1-C
LinkDB
Position
C169943:906..2222
AA seq 438 aa
MKVMKFGGTSVGSPERMKEVVDLVLRNNEPVFVVLSAMSGTTNTLIEVADYLYKKNHEGA
NEVINKLEQKYLAHIDELYSTNEYKEKTLRLFQEEFNYLRSFTNDIFTSFEEKSIVAQGE
VLSTNMVVNYLQEKGIKAKLLNALDFMRTDKNAEPDAAYIKEKLSAIMADNAGYQVYITQ
GFVCKNAYGEVDNLQRGGSDYTASLVGAAINAEEIQIWTDIDGMHNNDPRIVDNTEAVRQ
LNFEEASELAYFGAKILHPTCVQPAKYAGIPVRLKNTIEPDADGTIINNVMEHGKIKAIA
AKDNITVIKVRSSRMFGSPGFLRKVFEVFESYQVSIDLIATSEVGVSVAIEDATHLEEIT
DELKACGTVTIDANMCIVCVVGDLAWENIGFEIMAANALKDIPVRMISYGGSNYNISFLI
KGEDKKHALQSLSAALFN

DBGET integrated database retrieval system