KEGG   T30241 (Metagenome): 3910
Entry
3910              CDS       T30241                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
pary:A4V02_07325 (best score: 279.641)
Taxonomy
Bacteroidetes [GN:pary]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS015062.3910-T1-C
LinkDB
Position
C164312:3..641
AA seq 213 aa
KKEMKIRQADFAKKLASYADVYVNDAFGTAHRKHASTAVIADYFDADHKMLGFLMEKEVT
AINNVLKNAQHPFTAIIGGSKVSSKLGVIKNLLDKVDNLIIGGGMGYTFIKAQGGNVGLS
LHEDDLMPEALNVMAAAKKKGVNLSLSIASICAQQFSNDAERKEFPINQIPNDWEGMDAA
PESLEIWKKIILNSKTILWNGPVGVFEFENFAH

KEGG   T30241 (Metagenome): 8749
Entry
8749              CDS       T30241                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
pru:PRU_1634 (best score: 148.673)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS015062.8749-T1-C
LinkDB
Position
C169841:complement(2..316)
AA seq 105 aa
MKINDFNFAGQKAIVRVDFNVPLDENGNVTDDTRIRGALPTLKKVLADGGALIMMSHMGK
PKGKVKAELSLSQIVKNVSEALGVTVKFAKDAGNAEAEVAALKNG

KEGG   T30241 (Metagenome): 5218
Entry
5218              CDS       T30241                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
fnu:FN0654 (best score: 88.5817)
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS015062.5218-T1-C
LinkDB
Position
C166322:1..135
AA seq 44 aa
GDSAAAAISLGYADKFTHISTGGGASLEFLEGKVLPGVEAISNK

KEGG   T30241 (Metagenome): 3425
Entry
3425              CDS       T30241                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
fnu:FN0654 (best score: 338.191)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS015062.3425-T1-C
LinkDB
Position
C163452:complement(2..547)
AA seq 182 aa
LVRRTTMKKLITDLDLNNKKVLMRVDFNVPMKDGKITDENRIIQALPTIKYALEHNAKLI
LFSHLGKVKTEEDKSTKSLKAVAEKLSELLGKNVTFIPETKGEKLESAINNLKSGEVLMF
ENTRFEDLDGKKESKNDPELGKYWASLGDVFINDAFGTAHRAHASNVGIAENIGNGNSAV
GF

KEGG   T30241 (Metagenome): 3170
Entry
3170              CDS       T30241                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
fnu:FN0654 (best score: 301.982)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS015062.3170-T1-C
LinkDB
Position
C162994:complement(3..500)
AA seq 166 aa
EAVNNPKRPLIAILGGAKVSDKIGVIENLLTKADKILIGGAMMFTFLKAEGKNIGASLVE
DDKLDLAKDLLEKSNRKIVLPVDTVVANEFKNDTEFSTVDIDNIPDNKMGLDIGEKTVKL
FDSYIKTAKTVVWNGPMGVFEMPNFAKGTIGVCESIANLTDAVTII

KEGG   T30241 (Metagenome): 2686
Entry
2686              CDS       T30241                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
nso:NIASO_10335 (best score: 100.908)
Taxonomy
Bacteroidetes [GN:nso]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS015062.2686-T1-C
LinkDB
Position
C162097:1..189
AA seq 62 aa
AKYVAEATQKNGAFSLVGGGDSVAAVNKFGLADKVSYVSTGGGAMLEAIEGKVLPGVAAI
EK

KEGG   T30241 (Metagenome): 8161
Entry
8161              CDS       T30241                                 

Gene name
pgk
Definition
phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Best hit
nme:NMB0010 (best score: 570.852)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00010  Glycolysis / Gluconeogenesis
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04066  HIF-1 signaling pathway
Other DBs
HMP: SRS015062.8161-T1-C
LinkDB
Position
C169457:2..982
AA seq 326 aa
EFHPEDDVAPVAAHLGGLLGKNVKVLNDWRENKPALNAGDVVMLQNVRINKGEKKNDLEL
GKAYASLCDVFVNDAFGTAHRAQASTEAVAQAAPVACAGVLMAGELDALGKALKQPARPM
VAIVAGSKVSTKLTILESLADKVDQLIVGGGIANTFLLAEGKAIGKSLAEHDLVEESKKI
MAKMAAKGGSVPLPTDVVVAKAFTADEEAVVKDIADVAEDDMILDIGPKSAAELADLLKA
AGTVVWNGPVGVFEFDQFAGGTKALAEAIAQSKAFSIAGGGDTLAAIAKFGVTDQIGYIS
TGGGAFLEFLEGKELPAVAALEKRGA

DBGET integrated database retrieval system