KEGG   T30241 (Metagenome): 4306
Entry
4306              CDS       T30241                                 

Gene name
fumB
Definition
hydrolyase, tartrate alpha subunit/fumarate domain protein, Fe-S
type
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Best hit
nme:NMB1613 (best score: 479.559)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.4306-T1-C
LinkDB
Position
C164986:complement(2..739)
AA seq 246 aa
PAVIHMSIVPGGKVEVTCAAKGGGSENKSKLAMLNPSDNIVDWVLKTIPTMGAGWCPPGI
LGIGIGGTPEKAVLMAKESLMSHIDIQELQEKAASGAELSTTEALRLELFEKVNALGIGA
QGLGGLTTVLDVKILDYPTHAASKPIAMIPNCAATRHVEFELDGSGPVELTPPRVEDWPD
LTYSPDNGKRVDVDKLTKEEVASWKTGDVLLLNGKILTGRDAAHKRLVDMLNKGEELPVD
FTNRLI

KEGG   T30241 (Metagenome): 4054
Entry
4054              CDS       T30241                                 

Gene name
fumA
Definition
fumarate hydratase
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Best hit
nme:NMB1613 (best score: 270.396)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.4054-T1-C
LinkDB
Position
C164542:complement(2..508)
AA seq 169 aa
LSLPYKRWHYFNLIKNSLQKGCLKQQQTLTATTLKRNTIMTVIKQEDFIQSICDAFQFIS
YYHPKDYIDALYKAWQKEENPAAKDAMTQILVNSRMCAENNRPICQDTGIATVFLKVGMN
VQWDADMSVEEMVNEGVRRAYTWEGNTLRASVLADPAGKRQNTKDNTPA

KEGG   T30241 (Metagenome): 6644
Entry
6644              CDS       T30241                                 

Gene name
fumB
Definition
fumarate hydratase
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Best hit
nme:NMB1613 (best score: 245.743)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.6644-T1-C
LinkDB
Position
C168106:2..400
AA seq 132 aa
YVGPVDPVGDEVVGPAGPTTATRMDKFTRQMLEQTDLLGMIGKSERGVATCEAIADNKAV
YLMAVGGAAYLVAKAIKSSKVLAFPELGMEAIYEFEVKDMPVTVAVDSKGESIHATAPRK
WQAKIGIIPVES

KEGG   T30241 (Metagenome): 9097
Entry
9097              CDS       T30241                                 

Gene name
fumA
Definition
hydrolyase, tartrate beta subunit/fumarate domain protein, Fe-S type
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Best hit
pru:PRU_0119 (best score: 981.859)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.9097-T1-C
LinkDB
Position
C170019:complement(241..1884)
AA seq 547 aa
MAEFKYAPMFQLGKDETEYRLLSKEGITVANFEGKEIVKVAPEALTLLAQEAFHDCEFLL
RREHNEQVAAILKDDEASENDKYVALQFLRNAETAAKGVLPFCQDTGTAIIHGEKGQQIW
TGYEDEEALSLGVFNTFTQENLRYSQNAPLNMFDEVNTKCNLPAQIDIEATEGAEYKFVM
VAKGGGSANKTYFYPMTKATIQNEGTLIPFLVEKMKSLGTAACPPYHICFVIGGTSAEKN
LLTVKLGSIKYYDALPTTGDETGRAFCDIELEKKILEEAHKIGLGAQFGGKYLAHDIRII
RLPRHGASVPIGMGVSCSADRNIKGKINKDGIWLEKMDTNPGELIPEEYRKPGEGAKGIE
IDLDKGIDAVRAELTKHPVSTRVNLKGTIIVARDIAHAKLKARLDAGEPLPQYFKDYPVL
YAGPAKTPNGLPCGSMGPTTANRMDPYVDEFQANGGSLVMIAKGNRTQEVTDACKKHGGF
YLGTIGGVAAVLSQSSIKSIECVEYSELGMEAVYKITVEDFPAFILVDDKGNDFFKQLKP
WTGCPKK

KEGG   T30241 (Metagenome): 21
Entry
21                CDS       T30241                                 

Definition
fumarate hydratase class I, anaerobic
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Best hit
pru:PRU_0119 (best score: 328.561)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.21-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_119:122..643
AA seq 174 aa
MVAKGGGSANKTYFYPMTKATIQNESTLLPFLVEKMKSLGTAACPPYHICFVVGGTSAEK
NLLTVKLGSIKYYDNLPTTGDETGRAFRDIDLENKLLKEAHKIGLGAQFGGKALAHDIRV
IRLPRHGASCPIGMGVSCSADRNIKAKINADGIWLEKMDTNPSELIPEAYRKPG

KEGG   T30241 (Metagenome): 7242
Entry
7242              CDS       T30241                                 

Gene name
ttdA
Definition
hydrolyase, tartrate alpha subunit/fumarate domain protein, Fe-S
type
  KO
K01677  fumarate hydratase subunit alpha [EC:4.2.1.2]
Best hit
pit:PIN17_0471 (best score: 535.028)
Taxonomy
Bacteroidetes [GN:pit]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.7242-T1-C
LinkDB
Position
C168685:complement(776..1618)
AA seq 280 aa
MREIEASRITELVEKLCIEACYVLADDIYNKLAICQKQEKSPLASEIIGTIVKNADIART
ERVPMCQDTGMTVVFVRMGQECHVTGGFIEEAINQGVRQGYANGYLRKSVVKDPIDRVNT
TDNTPAIIHYEIVSGDEFHITVAPKGFGSENKSGLKMLTPSAGVKGIKEFVIDTIFHAGG
NPCPPIIVGIGIGGTMERAAFLSKKALLRPVGSVSEKPHIAQLEKELLEEINKLGIGPCG
FGGTTTALQVSILTNATHIAGLPVSVNIGCHATRHAEGSL

KEGG   T30241 (Metagenome): 7241
Entry
7241              CDS       T30241                                 

Gene name
fumB2
Definition
hydrolyase, tartrate beta subunit/fumarate domain protein, Fe-S type
  KO
K01678  fumarate hydratase subunit beta [EC:4.2.1.2]
Best hit
pit:PIN17_0472 (best score: 349.747)
Taxonomy
Bacteroidetes [GN:pit]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.7241-T1-C
LinkDB
Position
C168685:complement(196..750)
AA seq 184 aa
MEEKRIISAPFTDETIKSLHAGDMVYISGTIYTARDAAHKRLCEMLDAGEPMPFNFEGQA
VYYAGPCPAKPGQPIGSVGPTTGGRMDAYSPRLIQQGLRVMIGKGSRSEEVIDALKEHTG
VYFAAIGGAAALMAKAVKEAEVIAFDELGTEAIRRLRVEELPVIVAIDHEGNDMYKLGVK
KYRQ

KEGG   T30241 (Metagenome): 7626
Entry
7626              CDS       T30241                                 

Gene name
fumC
Definition
fumarate hydratase, class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
nme:NMB1458 (best score: 814.298)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS015062.7626-T1-C
LinkDB
Position
C169045:complement(1182..2462)
AA seq 426 aa
ETLPQPLIYALALVKKAAAATNVSLGRIKPEQADLITQAADDVLNGRLDGQFPLVVWQTG
SGTQSNMNMNEVLANRANEIAGTGLAAYQPVHPNDHVNHAQSTNDAFPTAIHVAAAIEIN
RHLIPAVKALRDTLDKKAQAFAPIVKIGRTHLQDATPLTLGQEFSGYVSQLDHGLGRLND
ALKDLYELALGGTAVGTGLNSHPEYAEKAAAKLAELSGLPFVSAPNKFEALGGRDAAVAA
SGALKTLAASLNKIANDIRWLASGPRCGLGEIKIPENEPGSSIMPGKVNPTQCEAMTMVC
CQVFGNDVTIGMAGASGNFELNVYMPVIAYNLLQSIRLLGDACNSFNEHCAIGIEPVPEK
IDYFLHHSLMLVTALNRKIGYENAAKVAKTAYKNNKSLRETAVELGLLTGEEFDELVVPA
DMVHPR

KEGG   T30241 (Metagenome): 4151
Entry
4151              CDS       T30241                                 

Definition
hypothetical protein
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
nme:NMB1458 (best score: 89.3521)
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS015062.4151-T1-C
LinkDB
Position
C164722:complement(3..125)
AA seq 41 aa
MSTRTEHDTMGNVEVPSEAYWGAQTQRSRNNFKIGGETLPQ

DBGET integrated database retrieval system