KEGG   T30241 (Metagenome): 4604
Entry
4604              CDS       T30241                                 

Gene name
sdhA
Definition
succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Best hit
bth:BT_3054 (best score: 177.948)
Taxonomy
Bacteroidetes [GN:bth]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05134  Legionellosis
Other DBs
HMP: SRS015062.4604-T1-C
LinkDB
Position
C165450:complement(3..317)
AA seq 105 aa
MAKILDSKIPEGPVAEKWTNYKAHQRLVNPKNKLKLDVIVVGTGLAGASAAASLGEMGFT
VYNFCIQDSPRRAHSIAAQGGINAAKNYQNDGDSIYRLFYDTVKG

KEGG   T30241 (Metagenome): 1038
Entry
1038              CDS       T30241                                 

Gene name
sdhA
Definition
succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Best hit
nme:NMB0950 (best score: 853.973)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05134  Legionellosis
Other DBs
HMP: SRS015062.1038-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_664:7603..8886
AA seq 428 aa
MGFPVRKFDAVIVGGGGAGLRAALQLSKSGLNCAVLSKVFPTRSHTVAAQGGISASLGNV
QEDRWDWHMYDTVKGSDWLGDQDAIEFMCRAAPEAVIELEHMGMPFDRVESGKIYQRPFG
GHTAEHGKRAVERACAVADRTGHAMLHTLYQQNVRANTQFFVEWTAQDLIRDENGDVVGV
TAMEMETGEVYIFHAKAVMFATGGGGRIYASSTNAYMNTGDGLGICARAGIPLEDMEFWQ
FHPTGVAGAGVLITEGVRGEGGILLNADGERFMERYAPTVKDLASRDVVSRAMAMEIYEG
RGCGKNKDHVLLKIDHIGAEKIMEKLPGIREISIQFAGIDPIKDPIPVVPTTHYMMGGIP
TNYHGEVVVPQGDEYEVPVKGLYAAGECACASVHGANRLGTNSLLDLVVFGKAAGDSMIK
FIKEQSDW

KEGG   T30241 (Metagenome): 6430
Entry
6430              CDS       T30241                                 

Gene name
sdhA
Definition
succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Best hit
nme:NMB0950 (best score: 311.227)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05134  Legionellosis
Other DBs
HMP: SRS015062.6430-T1-C
LinkDB
Position
C167882:1..477
AA seq 158 aa
PLPADAGELTRQRIERLDNQTDGENVDALRRELQRSVQLHAGVFRTDEILSKGVREVMAI
AERVKRTEIKDKSKVWNTARIEALELDNLIEVAKATLVSAEARKESRGAHASDDHPERDD
ENWMKHTLYHSDANTLSYKPVHTKPLSVEYIKPAKRVY

KEGG   T30241 (Metagenome): 5695
Entry
5695              CDS       T30241                                 

Gene name
sdhA
Definition
succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Best hit
pru:PRU_2432 (best score: 737.643)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05134  Legionellosis
Other DBs
HMP: SRS015062.5695-T1-C
LinkDB
Position
C167002:complement(1..1212)
AA seq 404 aa
GGDYRAREANVYRLAEVSNSIIDQCVAQGVPFAREYGGMLANRSFGGAQVSRTFYAKGQT
GQQLLLGAYSALSKQVNDGRVKLYTRYEMEDVVVVDDHARGIIAKNLVTGELERFSANAV
VIATGGYGNAYFLSTNAMGCNCTAAVQCYRKGAYFANPAFVQIHPTCIPVHGDKQSKLTL
MSESLRNDGRIWVPKNIEDAKALQAGTKKGSDIPEEERDYYLERRYPAFGNLVPRDVASR
AAKERCDHGFGVNNTGLAVFLDFSESINRLGLNVIRQRYGNLFDMYEEITDVNPGELAKE
INGVKYYNPMMIYPAIHYTMGGIWVDYELQTTIKGLFAIGECNFSDHGANRLGASALMQG
LADGYFVLPYTIQNYLADQSLWGKIPTDHPEFVKAEKGVQDEID

KEGG   T30241 (Metagenome): 682
Entry
682               CDS       T30241                                 

Gene name
sdhA
Definition
succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Best hit
pru:PRU_2432 (best score: 279.256)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05134  Legionellosis
Other DBs
HMP: SRS015062.682-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_579:complement(910..1392)
AA seq 160 aa
KGVQDEIDRLMNIKGKRSVDSIHKEFGRIMWDYVGMGRTKEGLETGLQKMKEIRKEFETN
LFIPGSKEGLNVELDKAIHLRDFITMGELVAYDAISRNESCGGHFREEYQTEEGEAKRDD
ENYFYVGCWEYKGSDTAEPELIKEPLEYEAIKVQTRNYKN

KEGG   T30241 (Metagenome): 1265
Entry
1265              CDS       T30241                                 

Definition
fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Best hit
pru:PRU_2432 (best score: 147.132)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05134  Legionellosis
Other DBs
HMP: SRS015062.1265-T1-C
LinkDB
Position
C159063:complement(2..304)
AA seq 101 aa
YTIQNYLADQALWPKVPTDRAEFVEAEEGVKKEIDRLMNIKGKRSVDSIHKELGHIMWEH
VGMGRTKEGLETGLKLLKELREEFNSNLFIPGKKEGLNIEL

KEGG   T30241 (Metagenome): 681
Entry
681               CDS       T30241                                 

Definition
succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Best hit
pru:PRU_2431 (best score: 445.277)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.681-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_579:complement(107..862)
AA seq 251 aa
MEKTISFTLKVWRQNGPTAQGHFDTFEMKDITGDTSFLEMLDILNEQLIEDGKEPFVFDH
DCREGICGMCSLYINGYPHGPATGATTCQLYMRRFNDGDVITVEPWRSAAFPVIKDCMVD
RGAFDKIIQAGGYTSIRTGQPQDANAILIPKEDADEAMDCATCIGCGACVAACKNGSAML
FLSSKVSQLALLPQGRPEAAKRAKAMIMKMEELGFGNCTNTRACEAECPKNESIANIARL
NREFIKAKLAD

KEGG   T30241 (Metagenome): 6431
Entry
6431              CDS       T30241                                 

Definition
succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Best hit
nme:NMB0951 (best score: 493.041)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.6431-T1-C
LinkDB
Position
C167882:576..1304
AA seq 242 aa
MRKGTLLMEKMSFEIYRYNPDVDAKPYMQRYELELEPTDVKLLDALVRLKAQDDTLSFRR
SCREGICGSDGMNINGKNGLACLTDLRGLKQPVKIRPLPGLPVIRDLIVDMTQFFKQYHS
VKPYVVNDNPIDADKERLQTQEERKELDGLYECILCACCSTACPSFWWNPDKFVGPSGLL
NAYRFIADSRDTITNERLDNLNDPYRLFRCHTIMNCVDVCPKHLNPTRAIGKIKEIMLKR
AV

KEGG   T30241 (Metagenome): 4605
Entry
4605              CDS       T30241                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
pru:PRU_2433 (best score: 231.491)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.4605-T1-C
LinkDB
Position
C165450:complement(350..820)
AA seq 156 aa
AFILTAQNRSARGNERYAVTGSSPKVEWASKNMLVLGIIVLLGMLLHLFNFWYNMMFAEI
VGMHTQFHPADGFAYIKETFANPVFVVLYIVWICAIWFHLSHGFWSAMQTLGINGKVWFN
RWKVIGLVYTSLLMLGFLIVVLAFAFGCAPSLCCIA

KEGG   T30241 (Metagenome): 1036
Entry
1036              CDS       T30241                                 

Gene name
sdhC
Definition
succinate dehydrogenase, cytochrome b556 subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
nme:NMB0948 (best score: 220.32)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.1036-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_664:6888..7265
AA seq 125 aa
MSAKPRPVYLDLPNIRLPIPGIVSILHRISGVGLFIMLPFLLYFLSGTLSQESAFETYRA
IVSHPLVKLVLIGVLWAYLHHSLAGIRFLFLDAHKGLELNTARNTAKAVFASALVLTVVL
GALLW

KEGG   T30241 (Metagenome): 582
Entry
582               CDS       T30241                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
pgi:PG_1616 (best score: 113.62)
Taxonomy
Bacteroidetes [GN:pgi]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.582-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_544:1132..1320
AA seq 63 aa
MWLINSSIGRKVVMSVTGIALILFLTFHMSMNIVALFSGEAYNMICEFLGANWYAVVATV
ALG

KEGG   T30241 (Metagenome): 1037
Entry
1037              CDS       T30241                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Best hit
nme:NMB0949 (best score: 232.261)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.1037-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_664:7259..7600
AA seq 113 aa
MVERKLTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSIKVIWG

DBGET integrated database retrieval system