KEGG   T30241 (Metagenome): 4750
Entry
4750              CDS       T30241                                 

Gene name
ribD
Definition
riboflavin biosynthesis protein ribD
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Best hit
pru:PRU_2399 (best score: 160.614)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00740  Riboflavin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02024  Quorum sensing
Other DBs
HMP: SRS015062.4750-T1-C
LinkDB
Position
C165646:2..583
AA seq 193 aa
LMLNREFIVRNTENRPYILLKWAQTANGFMGYSQAAGDGKPALQISNAFTKMLVHKLRAE
HDAILVGRNTEETEHPRLTVREWSGRNPQKIVMSSTYKTNTLADGTLCVNSLQHLVETIN
RRNETEQKICSLIVEGGARTLQSFIDAGLWDEIRVETAPFTINNGVAAPHLPHNIAVVKK
EFYGNTIITYKRL

KEGG   T30241 (Metagenome): 5517
Entry
5517              CDS       T30241                                 

Gene name
ribD
Definition
riboflavin biosynthesis protein ribD
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Best hit
fnu:FN1506 (best score: 405.986)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00740  Riboflavin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02024  Quorum sensing
Other DBs
HMP: SRS015062.5517-T1-C
LinkDB
Position
C166748:493..1125
AA seq 211 aa
MDEVLDEKYMARAIELAKRGIGGVNPNPLVGAVVVKDGKIIGEGWHKKYGGPHAEVWALN
EAGENTKGATIYVTLEPCSHQGKTPPCAKRIVEAGIKRCVVACIDPNPLVAGKGIKIMED
AGIEVELGVLEKEAKDVNKIFLKYIENKIPYLFLKCGITLDGKIATRSGKSKWITNEIAR
EKVQFLRTKFMAIMVGINTVLKDNPSLDSRL

KEGG   T30241 (Metagenome): 1954
Entry
1954              CDS       T30241                                 

Gene name
ribD
Definition
riboflavin biosynthesis protein ribD
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Best hit
pru:PRU_2399 (best score: 173.326)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00740  Riboflavin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02024  Quorum sensing
Other DBs
HMP: SRS015062.1954-T1-C
LinkDB
Position
C160566:complement(3..356)
AA seq 118 aa
MVGAVIVSGEGKIIGEGYHVRCGEGHAEVNAFRSVRSEDEHLLSEATVYVSLEPCSHHGK
TPPCADLIVRKGVRRVVCGCVDPFSAVQGRGIERIRKAGIDVTVGVLEQECLMLNREF

KEGG   T30241 (Metagenome): 1003
Entry
1003              CDS       T30241                                 

Gene name
ribD
Definition
riboflavin biosynthesis protein ribD
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Best hit
nme:NMB1817 (best score: 665.996)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00740  Riboflavin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02024  Quorum sensing
Other DBs
HMP: SRS015062.1003-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_658:complement(2103..3188)
AA seq 361 aa
MMENALRLAALGRFSTSPNPRVGCVIAHGSQIVGQGFHVKAGEPHAEVHALRQAGEMAQG
ATAFVTLEPCSHYGRTPPCAEALVRAGVSRVVAAMRDPNPLVAGKGLALLEAAGIKTECG
LLEHQARELNRGFLSRIERRRPFVRLKCAVSLDGKTALSDGSSFWITGEDARADVQVLRA
ESCAVLTGIGTVLADNPRLNVRAFPTLRQPARIVLDSRLRLPLDSHLLTDGQSPTYIATL
ERDEDKLRPYRKHAHVRILMPSETAGGKIDLNSLMRLLADEGIGELIVEAGSELTSAFLA
EDLADEIVLYRSPKILGSGKDLFSLPENRAALSAPPLWMPVSTEILGHDIKTVFRKNGNA
F

KEGG   T30241 (Metagenome): 3266
Entry
3266              CDS       T30241                                 

Definition
riboflavin biosynthesis protein ribD
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Best hit
fnu:FN1506 (best score: 287.73)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00740  Riboflavin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02024  Quorum sensing
Other DBs
HMP: SRS015062.3266-T1-C
LinkDB
Position
C163168:complement(57..518)
AA seq 153 aa
GIEKRNPFRVVIDPNLESPIEAKFLNFNDGKAIIITSNDNKGLEKIEKYKNLGTRFIFLE
GKIFKMEDILKELGKLEIDSVLLEGGSGLISTAFKENIIDAGEIFIAPKIIGDNSAIPFI
NGFNFDNMEEVFKLPNPKFNIYGDNISIEFKNL

DBGET integrated database retrieval system