KEGG   T30241 (Metagenome): 4790
Entry
4790              CDS       T30241                                 

Definition
hydroxyacylglutathione hydrolase
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Best hit
fnu:FN1162 (best score: 300.056)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.4790-T1-C
LinkDB
Position
C165718:complement(403..870)
AA seq 155 aa
ILTHGHGDHIEGLNDLASHYPEAKVYIGEEDKDFLYNSELSLSDAIFGEVFRFKGELITV
KEGDTIGDFKVIDTPGHTIGSKSFYDEKDKILMSGDTLFRRSYGRYDLPTGSLEMLCHSL
EKLSKLPDETVVYNGHTDNTTIGEERRFLERVGIL

KEGG   T30241 (Metagenome): 8724
Entry
8724              CDS       T30241                                 

Gene name
gloB
Definition
hydroxyacylglutathione hydrolase
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Best hit
nme:NMB1997 (best score: 522.316)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.8724-T1-C
LinkDB
Position
C169819:complement(147..905)
AA seq 252 aa
MKITPVKALTDNYIWMIQHGNHAVCVDPSEPSPVLEFLVRNRLMLAQTWVTHPHPDHEGG
AAALWRGYMESPVYGESDIEAATHTVTAGTQFTFGDGQVTVWATPGHTDRHTSYLLETSD
GIHVFCGDTLFSAGCGRVFTGTIEQLYDSFQRFNRLPENTLFYPAHEYTAANLDFAAHIE
PDNADIQTALKAAAHTPTLPVTLAHERRVNPFLRVDLPHVRDRAEALSGKTLNSSLDTFV
ALRELKNQYRTK

KEGG   T30241 (Metagenome): 4760
Entry
4760              CDS       T30241                                 

Definition
metallo-beta-lactamase domain protein
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Best hit
pru:PRU_1654 (best score: 254.218)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.4760-T1-C
LinkDB
Position
C165660:complement(230..856)
AA seq 208 aa
FVFNMIEENTYILWDDSLECVIIDCGAFYEEERQTIVNFIKENNLKPVHLLATHAHLDHN
FGINTINDVFGLLPEVSEKDAPALRSLKEQAQNMFGMQLNYDFPPVGNTFKAGETIKFGQ
HELAVINTPGHTPGGVTFYCKEENIAFTGDTLFRGSVGRTDFEGGSMFQLINSLRELSQL
PDNTVVYSGHGEQTTIGYELAHNPYMDR

KEGG   T30241 (Metagenome): 8133
Entry
8133              CDS       T30241                                 

Definition
putative hydrolase
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Best hit
nme:NMB2049 (best score: 441.039)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.8133-T1-C
LinkDB
Position
C169439:1100..1732
AA seq 210 aa
MTLRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGH
LDHAGGVVEMLKTHKVPVLGPHPDDEFLLQSLPQTTAQYGFPVSPAFAPNRWLEEGETLT
VGRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNK
LFTLPETVQVVAGHGRMTSIGHEKRHNPFF

DBGET integrated database retrieval system